From 30912788b1cd8e59529974ebb77af59c64534084 Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Mon, 18 Dec 2023 13:08:15 +0000 Subject: [PATCH] Bump github.com/minio/minio-go/v7 from 7.0.63 to 7.0.66 Bumps [github.com/minio/minio-go/v7](https://github.com/minio/minio-go) from 7.0.63 to 7.0.66. - [Release notes](https://github.com/minio/minio-go/releases) - [Commits](https://github.com/minio/minio-go/compare/v7.0.63...v7.0.66) --- updated-dependencies: - dependency-name: github.com/minio/minio-go/v7 dependency-type: direct:production update-type: version-update:semver-patch ... Signed-off-by: dependabot[bot] --- go.mod | 8 +- go.sum | 16 +- vendor/github.com/google/uuid/CHANGELOG.md | 18 + vendor/github.com/google/uuid/CONTRIBUTING.md | 2 +- vendor/github.com/google/uuid/time.go | 21 +- vendor/github.com/google/uuid/uuid.go | 79 +++- vendor/github.com/google/uuid/version6.go | 56 +++ vendor/github.com/google/uuid/version7.go | 75 ++++ .../github.com/klauspost/compress/README.md | 17 + .../klauspost/compress/flate/inflate.go | 66 ++- .../klauspost/compress/flate/inflate_gen.go | 34 +- .../klauspost/compress/fse/compress.go | 2 +- .../klauspost/compress/gzip/gunzip.go | 5 + .../klauspost/compress/huff0/bytereader.go | 44 -- .../klauspost/compress/huff0/compress.go | 5 +- .../klauspost/compress/huff0/huff0.go | 4 +- .../klauspost/compress/s2/encode.go | 2 +- .../klauspost/compress/s2/encode_best.go | 3 + .../klauspost/compress/s2/encode_go.go | 2 + .../klauspost/compress/zstd/README.md | 2 +- .../klauspost/compress/zstd/enc_best.go | 55 ++- .../klauspost/compress/zstd/enc_better.go | 17 +- .../github.com/klauspost/cpuid/v2/README.md | 14 +- vendor/github.com/klauspost/cpuid/v2/cpuid.go | 52 ++- .../klauspost/cpuid/v2/detect_x86.go | 1 + .../klauspost/cpuid/v2/featureid_string.go | 407 +++++++++--------- vendor/github.com/minio/minio-go/v7/README.md | 118 +++-- .../minio/minio-go/v7/api-get-object.go | 13 +- .../minio/minio-go/v7/api-get-options.go | 8 +- .../minio/minio-go/v7/api-object-tagging.go | 38 +- .../minio/minio-go/v7/api-put-object.go | 5 + .../minio-go/v7/api-putobject-snowball.go | 17 + vendor/github.com/minio/minio-go/v7/api.go | 2 +- .../v7/pkg/credentials/assume_role.go | 10 +- .../minio-go/v7/pkg/credentials/iam_aws.go | 106 +++-- .../minio-go/v7/pkg/lifecycle/lifecycle.go | 48 ++- .../v7/pkg/notification/notification.go | 9 + .../minio/minio-go/v7/s3-endpoints.go | 1 + vendor/github.com/minio/minio-go/v7/utils.go | 8 + vendor/modules.txt | 10 +- 40 files changed, 963 insertions(+), 437 deletions(-) create mode 100644 vendor/github.com/google/uuid/version6.go create mode 100644 vendor/github.com/google/uuid/version7.go delete mode 100644 vendor/github.com/klauspost/compress/huff0/bytereader.go diff --git a/go.mod b/go.mod index 65dab7284..1dd488f76 100644 --- a/go.mod +++ b/go.mod @@ -11,7 +11,7 @@ require ( github.com/ip2location/ip2location-go/v9 v9.6.1 github.com/json-iterator/go v1.1.12 github.com/mariomac/guara v0.0.0-20220523124851-5fc279816f1f - github.com/minio/minio-go/v7 v7.0.63 + github.com/minio/minio-go/v7 v7.0.66 github.com/mitchellh/mapstructure v1.5.0 github.com/netobserv/gopipes v0.3.0 github.com/netobserv/loki-client-go v0.0.0-20220927092034-f37122a54500 @@ -56,14 +56,14 @@ require ( github.com/google/gnostic-models v0.6.8 // indirect github.com/google/go-cmp v0.5.9 // indirect github.com/google/gofuzz v1.2.0 // indirect - github.com/google/uuid v1.3.1 // indirect + github.com/google/uuid v1.5.0 // indirect github.com/hashicorp/hcl v1.0.0 // indirect github.com/imdario/mergo v0.3.15 // indirect github.com/inconshreveable/mousetrap v1.1.0 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/jpillora/backoff v1.0.0 // indirect - github.com/klauspost/compress v1.17.0 // indirect - github.com/klauspost/cpuid/v2 v2.2.5 // indirect + github.com/klauspost/compress v1.17.4 // indirect + github.com/klauspost/cpuid/v2 v2.2.6 // indirect github.com/libp2p/go-reuseport v0.3.0 // indirect github.com/magiconair/properties v1.8.7 // indirect github.com/mailru/easyjson v0.7.7 // indirect diff --git a/go.sum b/go.sum index 66312fa47..866ecf07c 100644 --- a/go.sum +++ b/go.sum @@ -406,8 +406,8 @@ github.com/google/renameio v0.1.0/go.mod h1:KWCgfxg9yswjAJkECMjeO8J8rahYeXnNhOm4 github.com/google/uuid v1.0.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.1.1/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.1.2/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= -github.com/google/uuid v1.3.1 h1:KjJaJ9iWZ3jOFZIf1Lqf4laDRCasjl0BCmnEGxkdLb4= -github.com/google/uuid v1.3.1/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= +github.com/google/uuid v1.5.0 h1:1p67kYwdtXjb0gL0BPiP1Av9wiZPo5A8z2cWkTZ+eyU= +github.com/google/uuid v1.5.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/googleapis/gax-go/v2 v2.0.4/go.mod h1:0Wqv26UfaUD9n4G6kQubkQ+KchISgw+vpHVxEJEs9eg= github.com/googleapis/gax-go/v2 v2.0.5/go.mod h1:DWXyrwAJ9X0FpwwEdw+IPEYBICEFu5mhpdKc/us6bOk= github.com/googleapis/gnostic v0.4.1/go.mod h1:LRhVm6pbyptWbWbuZ38d1eyptfvIytN3ir6b65WBswg= @@ -520,12 +520,12 @@ github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+o github.com/klauspost/compress v1.4.0/go.mod h1:RyIbtBH6LamlWaDj8nUwkbUhJ87Yi3uG0guNDohfE1A= github.com/klauspost/compress v1.9.5/go.mod h1:RyIbtBH6LamlWaDj8nUwkbUhJ87Yi3uG0guNDohfE1A= github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHUDtV4Yw2GlzU= -github.com/klauspost/compress v1.17.0 h1:Rnbp4K9EjcDuVuHtd0dgA4qNuv9yKDYKK1ulpJwgrqM= -github.com/klauspost/compress v1.17.0/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE= +github.com/klauspost/compress v1.17.4 h1:Ej5ixsIri7BrIjBkRZLTo6ghwrEtHFk7ijlczPW4fZ4= +github.com/klauspost/compress v1.17.4/go.mod h1:/dCuZOvVtNoHsyb+cuJD3itjs3NbnF6KH9zAO4BDxPM= github.com/klauspost/cpuid v0.0.0-20170728055534-ae7887de9fa5/go.mod h1:Pj4uuM528wm8OyEC2QMXAi2YiTZ96dNQPGgoMS4s3ek= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= -github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc= +github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/klauspost/crc32 v0.0.0-20161016154125-cb6bfca970f6/go.mod h1:+ZoRqAPRLkC4NPOvfYeR5KNOrY6TD+/sAC3HXPZgDYg= github.com/klauspost/pgzip v1.0.2-0.20170402124221-0bf5dcad4ada/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= @@ -589,8 +589,8 @@ github.com/miekg/dns v1.1.26/go.mod h1:bPDLeHnStXmXAq1m/Ch/hvfNHr14JKNPMBo3VZKju github.com/miekg/dns v1.1.31/go.mod h1:KNUDUusw/aVsxyTYZM1oqvCicbwhgbNgztCETuNZ7xM= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= -github.com/minio/minio-go/v7 v7.0.63 h1:GbZ2oCvaUdgT5640WJOpyDhhDxvknAJU2/T3yurwcbQ= -github.com/minio/minio-go/v7 v7.0.63/go.mod h1:Q6X7Qjb7WMhvG65qKf4gUgA5XaiSox74kR1uAEjxRS4= +github.com/minio/minio-go/v7 v7.0.66 h1:bnTOXOHjOqv/gcMuiVbN9o2ngRItvqE774dG9nq0Dzw= +github.com/minio/minio-go/v7 v7.0.66/go.mod h1:DHAgmyQEGdW3Cif0UooKOyrT3Vxs82zNdV6tkKhRtbs= github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM= github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8= github.com/mitchellh/cli v1.0.0/go.mod h1:hNIlj7HEI86fIcpObd7a0FcrxTWetlwJDGcceTlRvqc= diff --git a/vendor/github.com/google/uuid/CHANGELOG.md b/vendor/github.com/google/uuid/CHANGELOG.md index 2bd78667a..c9fb829dc 100644 --- a/vendor/github.com/google/uuid/CHANGELOG.md +++ b/vendor/github.com/google/uuid/CHANGELOG.md @@ -1,5 +1,23 @@ # Changelog +## [1.5.0](https://github.com/google/uuid/compare/v1.4.0...v1.5.0) (2023-12-12) + + +### Features + +* Validate UUID without creating new UUID ([#141](https://github.com/google/uuid/issues/141)) ([9ee7366](https://github.com/google/uuid/commit/9ee7366e66c9ad96bab89139418a713dc584ae29)) + +## [1.4.0](https://github.com/google/uuid/compare/v1.3.1...v1.4.0) (2023-10-26) + + +### Features + +* UUIDs slice type with Strings() convenience method ([#133](https://github.com/google/uuid/issues/133)) ([cd5fbbd](https://github.com/google/uuid/commit/cd5fbbdd02f3e3467ac18940e07e062be1f864b4)) + +### Fixes + +* Clarify that Parse's job is to parse but not necessarily validate strings. (Documents current behavior) + ## [1.3.1](https://github.com/google/uuid/compare/v1.3.0...v1.3.1) (2023-08-18) diff --git a/vendor/github.com/google/uuid/CONTRIBUTING.md b/vendor/github.com/google/uuid/CONTRIBUTING.md index 556688872..a502fdc51 100644 --- a/vendor/github.com/google/uuid/CONTRIBUTING.md +++ b/vendor/github.com/google/uuid/CONTRIBUTING.md @@ -11,7 +11,7 @@ please explain why in the pull request description. ### Releasing -Commits that would precipitate a SemVer change, as desrcibed in the Conventional +Commits that would precipitate a SemVer change, as described in the Conventional Commits Specification, will trigger [`release-please`](https://github.com/google-github-actions/release-please-action) to create a release candidate pull request. Once submitted, `release-please` will create a release. diff --git a/vendor/github.com/google/uuid/time.go b/vendor/github.com/google/uuid/time.go index e6ef06cdc..c35112927 100644 --- a/vendor/github.com/google/uuid/time.go +++ b/vendor/github.com/google/uuid/time.go @@ -108,12 +108,23 @@ func setClockSequence(seq int) { } // Time returns the time in 100s of nanoseconds since 15 Oct 1582 encoded in -// uuid. The time is only defined for version 1 and 2 UUIDs. +// uuid. The time is only defined for version 1, 2, 6 and 7 UUIDs. func (uuid UUID) Time() Time { - time := int64(binary.BigEndian.Uint32(uuid[0:4])) - time |= int64(binary.BigEndian.Uint16(uuid[4:6])) << 32 - time |= int64(binary.BigEndian.Uint16(uuid[6:8])&0xfff) << 48 - return Time(time) + var t Time + switch uuid.Version() { + case 6: + time := binary.BigEndian.Uint64(uuid[:8]) // Ignore uuid[6] version b0110 + t = Time(time) + case 7: + time := binary.BigEndian.Uint64(uuid[:8]) + t = Time((time>>16)*10000 + g1582ns100) + default: // forward compatible + time := int64(binary.BigEndian.Uint32(uuid[0:4])) + time |= int64(binary.BigEndian.Uint16(uuid[4:6])) << 32 + time |= int64(binary.BigEndian.Uint16(uuid[6:8])&0xfff) << 48 + t = Time(time) + } + return t } // ClockSequence returns the clock sequence encoded in uuid. diff --git a/vendor/github.com/google/uuid/uuid.go b/vendor/github.com/google/uuid/uuid.go index a56138cc4..5232b4867 100644 --- a/vendor/github.com/google/uuid/uuid.go +++ b/vendor/github.com/google/uuid/uuid.go @@ -56,11 +56,15 @@ func IsInvalidLengthError(err error) bool { return ok } -// Parse decodes s into a UUID or returns an error. Both the standard UUID -// forms of xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx and -// urn:uuid:xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx are decoded as well as the -// Microsoft encoding {xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx} and the raw hex -// encoding: xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx. +// Parse decodes s into a UUID or returns an error if it cannot be parsed. Both +// the standard UUID forms defined in RFC 4122 +// (xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx and +// urn:uuid:xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx) are decoded. In addition, +// Parse accepts non-standard strings such as the raw hex encoding +// xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx and 38 byte "Microsoft style" encodings, +// e.g. {xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx}. Only the middle 36 bytes are +// examined in the latter case. Parse should not be used to validate strings as +// it parses non-standard encodings as indicated above. func Parse(s string) (UUID, error) { var uuid UUID switch len(s) { @@ -182,6 +186,59 @@ func Must(uuid UUID, err error) UUID { return uuid } +// Validate returns an error if s is not a properly formatted UUID in one of the following formats: +// xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx +// urn:uuid:xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx +// xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx +// {xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx} +// It returns an error if the format is invalid, otherwise nil. +func Validate(s string) error { + switch len(s) { + // Standard UUID format + case 36: + + // UUID with "urn:uuid:" prefix + case 36 + 9: + if !strings.EqualFold(s[:9], "urn:uuid:") { + return fmt.Errorf("invalid urn prefix: %q", s[:9]) + } + s = s[9:] + + // UUID enclosed in braces + case 36 + 2: + if s[0] != '{' || s[len(s)-1] != '}' { + return fmt.Errorf("invalid bracketed UUID format") + } + s = s[1 : len(s)-1] + + // UUID without hyphens + case 32: + for i := 0; i < len(s); i += 2 { + _, ok := xtob(s[i], s[i+1]) + if !ok { + return errors.New("invalid UUID format") + } + } + + default: + return invalidLengthError{len(s)} + } + + // Check for standard UUID format + if len(s) == 36 { + if s[8] != '-' || s[13] != '-' || s[18] != '-' || s[23] != '-' { + return errors.New("invalid UUID format") + } + for _, x := range []int{0, 2, 4, 6, 9, 11, 14, 16, 19, 21, 24, 26, 28, 30, 32, 34} { + if _, ok := xtob(s[x], s[x+1]); !ok { + return errors.New("invalid UUID format") + } + } + } + + return nil +} + // String returns the string form of uuid, xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx // , or "" if uuid is invalid. func (uuid UUID) String() string { @@ -294,3 +351,15 @@ func DisableRandPool() { poolMu.Lock() poolPos = randPoolSize } + +// UUIDs is a slice of UUID types. +type UUIDs []UUID + +// Strings returns a string slice containing the string form of each UUID in uuids. +func (uuids UUIDs) Strings() []string { + var uuidStrs = make([]string, len(uuids)) + for i, uuid := range uuids { + uuidStrs[i] = uuid.String() + } + return uuidStrs +} diff --git a/vendor/github.com/google/uuid/version6.go b/vendor/github.com/google/uuid/version6.go new file mode 100644 index 000000000..339a959a7 --- /dev/null +++ b/vendor/github.com/google/uuid/version6.go @@ -0,0 +1,56 @@ +// Copyright 2023 Google Inc. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package uuid + +import "encoding/binary" + +// UUID version 6 is a field-compatible version of UUIDv1, reordered for improved DB locality. +// It is expected that UUIDv6 will primarily be used in contexts where there are existing v1 UUIDs. +// Systems that do not involve legacy UUIDv1 SHOULD consider using UUIDv7 instead. +// +// see https://datatracker.ietf.org/doc/html/draft-peabody-dispatch-new-uuid-format-03#uuidv6 +// +// NewV6 returns a Version 6 UUID based on the current NodeID and clock +// sequence, and the current time. If the NodeID has not been set by SetNodeID +// or SetNodeInterface then it will be set automatically. If the NodeID cannot +// be set NewV6 set NodeID is random bits automatically . If clock sequence has not been set by +// SetClockSequence then it will be set automatically. If GetTime fails to +// return the current NewV6 returns Nil and an error. +func NewV6() (UUID, error) { + var uuid UUID + now, seq, err := GetTime() + if err != nil { + return uuid, err + } + + /* + 0 1 2 3 + 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 9 0 1 + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + | time_high | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + | time_mid | time_low_and_version | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + |clk_seq_hi_res | clk_seq_low | node (0-1) | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + | node (2-5) | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + */ + + binary.BigEndian.PutUint64(uuid[0:], uint64(now)) + binary.BigEndian.PutUint16(uuid[8:], seq) + + uuid[6] = 0x60 | (uuid[6] & 0x0F) + uuid[8] = 0x80 | (uuid[8] & 0x3F) + + nodeMu.Lock() + if nodeID == zeroID { + setNodeInterface("") + } + copy(uuid[10:], nodeID[:]) + nodeMu.Unlock() + + return uuid, nil +} diff --git a/vendor/github.com/google/uuid/version7.go b/vendor/github.com/google/uuid/version7.go new file mode 100644 index 000000000..ba9dd5eb6 --- /dev/null +++ b/vendor/github.com/google/uuid/version7.go @@ -0,0 +1,75 @@ +// Copyright 2023 Google Inc. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package uuid + +import ( + "io" +) + +// UUID version 7 features a time-ordered value field derived from the widely +// implemented and well known Unix Epoch timestamp source, +// the number of milliseconds seconds since midnight 1 Jan 1970 UTC, leap seconds excluded. +// As well as improved entropy characteristics over versions 1 or 6. +// +// see https://datatracker.ietf.org/doc/html/draft-peabody-dispatch-new-uuid-format-03#name-uuid-version-7 +// +// Implementations SHOULD utilize UUID version 7 over UUID version 1 and 6 if possible. +// +// NewV7 returns a Version 7 UUID based on the current time(Unix Epoch). +// Uses the randomness pool if it was enabled with EnableRandPool. +// On error, NewV7 returns Nil and an error +func NewV7() (UUID, error) { + uuid, err := NewRandom() + if err != nil { + return uuid, err + } + makeV7(uuid[:]) + return uuid, nil +} + +// NewV7FromReader returns a Version 7 UUID based on the current time(Unix Epoch). +// it use NewRandomFromReader fill random bits. +// On error, NewV7FromReader returns Nil and an error. +func NewV7FromReader(r io.Reader) (UUID, error) { + uuid, err := NewRandomFromReader(r) + if err != nil { + return uuid, err + } + + makeV7(uuid[:]) + return uuid, nil +} + +// makeV7 fill 48 bits time (uuid[0] - uuid[5]), set version b0111 (uuid[6]) +// uuid[8] already has the right version number (Variant is 10) +// see function NewV7 and NewV7FromReader +func makeV7(uuid []byte) { + /* + 0 1 2 3 + 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 9 0 1 + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + | unix_ts_ms | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + | unix_ts_ms | ver | rand_a | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + |var| rand_b | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + | rand_b | + +-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+ + */ + _ = uuid[15] // bounds check + + t := timeNow().UnixMilli() + + uuid[0] = byte(t >> 40) + uuid[1] = byte(t >> 32) + uuid[2] = byte(t >> 24) + uuid[3] = byte(t >> 16) + uuid[4] = byte(t >> 8) + uuid[5] = byte(t) + + uuid[6] = 0x70 | (uuid[6] & 0x0F) + // uuid[8] has already has right version +} diff --git a/vendor/github.com/klauspost/compress/README.md b/vendor/github.com/klauspost/compress/README.md index dde75389f..7e83f583c 100644 --- a/vendor/github.com/klauspost/compress/README.md +++ b/vendor/github.com/klauspost/compress/README.md @@ -16,6 +16,22 @@ This package provides various compression algorithms. # changelog +* Oct 22nd, 2023 - [v1.17.2](https://github.com/klauspost/compress/releases/tag/v1.17.2) + * zstd: Fix rare *CORRUPTION* output in "best" mode. See https://github.com/klauspost/compress/pull/876 + +* Oct 14th, 2023 - [v1.17.1](https://github.com/klauspost/compress/releases/tag/v1.17.1) + * s2: Fix S2 "best" dictionary wrong encoding by @klauspost in https://github.com/klauspost/compress/pull/871 + * flate: Reduce allocations in decompressor and minor code improvements by @fakefloordiv in https://github.com/klauspost/compress/pull/869 + * s2: Fix EstimateBlockSize on 6&7 length input by @klauspost in https://github.com/klauspost/compress/pull/867 + +* Sept 19th, 2023 - [v1.17.0](https://github.com/klauspost/compress/releases/tag/v1.17.0) + * Add experimental dictionary builder https://github.com/klauspost/compress/pull/853 + * Add xerial snappy read/writer https://github.com/klauspost/compress/pull/838 + * flate: Add limited window compression https://github.com/klauspost/compress/pull/843 + * s2: Do 2 overlapping match checks https://github.com/klauspost/compress/pull/839 + * flate: Add amd64 assembly matchlen https://github.com/klauspost/compress/pull/837 + * gzip: Copy bufio.Reader on Reset by @thatguystone in https://github.com/klauspost/compress/pull/860 + * July 1st, 2023 - [v1.16.7](https://github.com/klauspost/compress/releases/tag/v1.16.7) * zstd: Fix default level first dictionary encode https://github.com/klauspost/compress/pull/829 * s2: add GetBufferCapacity() method by @GiedriusS in https://github.com/klauspost/compress/pull/832 @@ -646,6 +662,7 @@ Here are other packages of good quality and pure Go (no cgo wrappers or autoconv * [github.com/ronanh/intcomp](https://github.com/ronanh/intcomp) - Integer compression. * [github.com/spenczar/fpc](https://github.com/spenczar/fpc) - Float compression. * [github.com/minio/zipindex](https://github.com/minio/zipindex) - External ZIP directory index. +* [github.com/ybirader/pzip](https://github.com/ybirader/pzip) - Fast concurrent zip archiver and extractor. # license diff --git a/vendor/github.com/klauspost/compress/flate/inflate.go b/vendor/github.com/klauspost/compress/flate/inflate.go index 414c0bea9..2f410d64f 100644 --- a/vendor/github.com/klauspost/compress/flate/inflate.go +++ b/vendor/github.com/klauspost/compress/flate/inflate.go @@ -120,8 +120,9 @@ func (h *huffmanDecoder) init(lengths []int) bool { const sanity = false if h.chunks == nil { - h.chunks = &[huffmanNumChunks]uint16{} + h.chunks = new([huffmanNumChunks]uint16) } + if h.maxRead != 0 { *h = huffmanDecoder{chunks: h.chunks, links: h.links} } @@ -175,6 +176,7 @@ func (h *huffmanDecoder) init(lengths []int) bool { } h.maxRead = min + chunks := h.chunks[:] for i := range chunks { chunks[i] = 0 @@ -202,8 +204,7 @@ func (h *huffmanDecoder) init(lengths []int) bool { if cap(h.links[off]) < numLinks { h.links[off] = make([]uint16, numLinks) } else { - links := h.links[off][:0] - h.links[off] = links[:numLinks] + h.links[off] = h.links[off][:numLinks] } } } else { @@ -277,7 +278,7 @@ func (h *huffmanDecoder) init(lengths []int) bool { return true } -// The actual read interface needed by NewReader. +// Reader is the actual read interface needed by NewReader. // If the passed in io.Reader does not also have ReadByte, // the NewReader will introduce its own buffering. type Reader interface { @@ -285,6 +286,18 @@ type Reader interface { io.ByteReader } +type step uint8 + +const ( + copyData step = iota + 1 + nextBlock + huffmanBytesBuffer + huffmanBytesReader + huffmanBufioReader + huffmanStringsReader + huffmanGenericReader +) + // Decompress state. type decompressor struct { // Input source. @@ -303,7 +316,7 @@ type decompressor struct { // Next step in the decompression, // and decompression state. - step func(*decompressor) + step step stepState int err error toRead []byte @@ -342,7 +355,7 @@ func (f *decompressor) nextBlock() { // compressed, fixed Huffman tables f.hl = &fixedHuffmanDecoder f.hd = nil - f.huffmanBlockDecoder()() + f.huffmanBlockDecoder() if debugDecode { fmt.Println("predefinied huffman block") } @@ -353,7 +366,7 @@ func (f *decompressor) nextBlock() { } f.hl = &f.h1 f.hd = &f.h2 - f.huffmanBlockDecoder()() + f.huffmanBlockDecoder() if debugDecode { fmt.Println("dynamic huffman block") } @@ -379,14 +392,16 @@ func (f *decompressor) Read(b []byte) (int, error) { if f.err != nil { return 0, f.err } - f.step(f) + + f.doStep() + if f.err != nil && len(f.toRead) == 0 { f.toRead = f.dict.readFlush() // Flush what's left in case of error } } } -// Support the io.WriteTo interface for io.Copy and friends. +// WriteTo implements the io.WriteTo interface for io.Copy and friends. func (f *decompressor) WriteTo(w io.Writer) (int64, error) { total := int64(0) flushed := false @@ -410,7 +425,7 @@ func (f *decompressor) WriteTo(w io.Writer) (int64, error) { return total, f.err } if f.err == nil { - f.step(f) + f.doStep() } if len(f.toRead) == 0 && f.err != nil && !flushed { f.toRead = f.dict.readFlush() // Flush what's left in case of error @@ -631,7 +646,7 @@ func (f *decompressor) copyData() { if f.dict.availWrite() == 0 || f.copyLen > 0 { f.toRead = f.dict.readFlush() - f.step = (*decompressor).copyData + f.step = copyData return } f.finishBlock() @@ -644,7 +659,28 @@ func (f *decompressor) finishBlock() { } f.err = io.EOF } - f.step = (*decompressor).nextBlock + f.step = nextBlock +} + +func (f *decompressor) doStep() { + switch f.step { + case copyData: + f.copyData() + case nextBlock: + f.nextBlock() + case huffmanBytesBuffer: + f.huffmanBytesBuffer() + case huffmanBytesReader: + f.huffmanBytesReader() + case huffmanBufioReader: + f.huffmanBufioReader() + case huffmanStringsReader: + f.huffmanStringsReader() + case huffmanGenericReader: + f.huffmanGenericReader() + default: + panic("BUG: unexpected step state") + } } // noEOF returns err, unless err == io.EOF, in which case it returns io.ErrUnexpectedEOF. @@ -747,7 +783,7 @@ func (f *decompressor) Reset(r io.Reader, dict []byte) error { h1: f.h1, h2: f.h2, dict: f.dict, - step: (*decompressor).nextBlock, + step: nextBlock, } f.dict.init(maxMatchOffset, dict) return nil @@ -768,7 +804,7 @@ func NewReader(r io.Reader) io.ReadCloser { f.r = makeReader(r) f.bits = new([maxNumLit + maxNumDist]int) f.codebits = new([numCodes]int) - f.step = (*decompressor).nextBlock + f.step = nextBlock f.dict.init(maxMatchOffset, nil) return &f } @@ -787,7 +823,7 @@ func NewReaderDict(r io.Reader, dict []byte) io.ReadCloser { f.r = makeReader(r) f.bits = new([maxNumLit + maxNumDist]int) f.codebits = new([numCodes]int) - f.step = (*decompressor).nextBlock + f.step = nextBlock f.dict.init(maxMatchOffset, dict) return &f } diff --git a/vendor/github.com/klauspost/compress/flate/inflate_gen.go b/vendor/github.com/klauspost/compress/flate/inflate_gen.go index 61342b6b8..2b2f993f7 100644 --- a/vendor/github.com/klauspost/compress/flate/inflate_gen.go +++ b/vendor/github.com/klauspost/compress/flate/inflate_gen.go @@ -85,7 +85,7 @@ readLiteral: dict.writeByte(byte(v)) if dict.availWrite() == 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanBytesBuffer + f.step = huffmanBytesBuffer f.stepState = stateInit f.b, f.nb = fb, fnb return @@ -251,7 +251,7 @@ copyHistory: if dict.availWrite() == 0 || f.copyLen > 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanBytesBuffer // We need to continue this work + f.step = huffmanBytesBuffer // We need to continue this work f.stepState = stateDict f.b, f.nb = fb, fnb return @@ -336,7 +336,7 @@ readLiteral: dict.writeByte(byte(v)) if dict.availWrite() == 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanBytesReader + f.step = huffmanBytesReader f.stepState = stateInit f.b, f.nb = fb, fnb return @@ -502,7 +502,7 @@ copyHistory: if dict.availWrite() == 0 || f.copyLen > 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanBytesReader // We need to continue this work + f.step = huffmanBytesReader // We need to continue this work f.stepState = stateDict f.b, f.nb = fb, fnb return @@ -587,7 +587,7 @@ readLiteral: dict.writeByte(byte(v)) if dict.availWrite() == 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanBufioReader + f.step = huffmanBufioReader f.stepState = stateInit f.b, f.nb = fb, fnb return @@ -753,7 +753,7 @@ copyHistory: if dict.availWrite() == 0 || f.copyLen > 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanBufioReader // We need to continue this work + f.step = huffmanBufioReader // We need to continue this work f.stepState = stateDict f.b, f.nb = fb, fnb return @@ -838,7 +838,7 @@ readLiteral: dict.writeByte(byte(v)) if dict.availWrite() == 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanStringsReader + f.step = huffmanStringsReader f.stepState = stateInit f.b, f.nb = fb, fnb return @@ -1004,7 +1004,7 @@ copyHistory: if dict.availWrite() == 0 || f.copyLen > 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanStringsReader // We need to continue this work + f.step = huffmanStringsReader // We need to continue this work f.stepState = stateDict f.b, f.nb = fb, fnb return @@ -1089,7 +1089,7 @@ readLiteral: dict.writeByte(byte(v)) if dict.availWrite() == 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanGenericReader + f.step = huffmanGenericReader f.stepState = stateInit f.b, f.nb = fb, fnb return @@ -1255,7 +1255,7 @@ copyHistory: if dict.availWrite() == 0 || f.copyLen > 0 { f.toRead = dict.readFlush() - f.step = (*decompressor).huffmanGenericReader // We need to continue this work + f.step = huffmanGenericReader // We need to continue this work f.stepState = stateDict f.b, f.nb = fb, fnb return @@ -1265,19 +1265,19 @@ copyHistory: // Not reached } -func (f *decompressor) huffmanBlockDecoder() func() { +func (f *decompressor) huffmanBlockDecoder() { switch f.r.(type) { case *bytes.Buffer: - return f.huffmanBytesBuffer + f.huffmanBytesBuffer() case *bytes.Reader: - return f.huffmanBytesReader + f.huffmanBytesReader() case *bufio.Reader: - return f.huffmanBufioReader + f.huffmanBufioReader() case *strings.Reader: - return f.huffmanStringsReader + f.huffmanStringsReader() case Reader: - return f.huffmanGenericReader + f.huffmanGenericReader() default: - return f.huffmanGenericReader + f.huffmanGenericReader() } } diff --git a/vendor/github.com/klauspost/compress/fse/compress.go b/vendor/github.com/klauspost/compress/fse/compress.go index 65d777357..074018d8f 100644 --- a/vendor/github.com/klauspost/compress/fse/compress.go +++ b/vendor/github.com/klauspost/compress/fse/compress.go @@ -212,7 +212,7 @@ func (s *Scratch) writeCount() error { previous0 bool charnum uint16 - maxHeaderSize = ((int(s.symbolLen) * int(tableLog)) >> 3) + 3 + maxHeaderSize = ((int(s.symbolLen)*int(tableLog) + 4 + 2) >> 3) + 3 // Write Table Size bitStream = uint32(tableLog - minTablelog) diff --git a/vendor/github.com/klauspost/compress/gzip/gunzip.go b/vendor/github.com/klauspost/compress/gzip/gunzip.go index dc2362a63..00a0a2c38 100644 --- a/vendor/github.com/klauspost/compress/gzip/gunzip.go +++ b/vendor/github.com/klauspost/compress/gzip/gunzip.go @@ -238,6 +238,11 @@ func (z *Reader) readHeader() (hdr Header, err error) { } } + // Reserved FLG bits must be zero. + if flg>>5 != 0 { + return hdr, ErrHeader + } + z.digest = 0 if z.decompressor == nil { z.decompressor = flate.NewReader(z.r) diff --git a/vendor/github.com/klauspost/compress/huff0/bytereader.go b/vendor/github.com/klauspost/compress/huff0/bytereader.go deleted file mode 100644 index 4dcab8d23..000000000 --- a/vendor/github.com/klauspost/compress/huff0/bytereader.go +++ /dev/null @@ -1,44 +0,0 @@ -// Copyright 2018 Klaus Post. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. -// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. - -package huff0 - -// byteReader provides a byte reader that reads -// little endian values from a byte stream. -// The input stream is manually advanced. -// The reader performs no bounds checks. -type byteReader struct { - b []byte - off int -} - -// init will initialize the reader and set the input. -func (b *byteReader) init(in []byte) { - b.b = in - b.off = 0 -} - -// Int32 returns a little endian int32 starting at current offset. -func (b byteReader) Int32() int32 { - v3 := int32(b.b[b.off+3]) - v2 := int32(b.b[b.off+2]) - v1 := int32(b.b[b.off+1]) - v0 := int32(b.b[b.off]) - return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0 -} - -// Uint32 returns a little endian uint32 starting at current offset. -func (b byteReader) Uint32() uint32 { - v3 := uint32(b.b[b.off+3]) - v2 := uint32(b.b[b.off+2]) - v1 := uint32(b.b[b.off+1]) - v0 := uint32(b.b[b.off]) - return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0 -} - -// remain will return the number of bytes remaining. -func (b byteReader) remain() int { - return len(b.b) - b.off -} diff --git a/vendor/github.com/klauspost/compress/huff0/compress.go b/vendor/github.com/klauspost/compress/huff0/compress.go index 518436cf3..84aa3d12f 100644 --- a/vendor/github.com/klauspost/compress/huff0/compress.go +++ b/vendor/github.com/klauspost/compress/huff0/compress.go @@ -350,6 +350,7 @@ func (s *Scratch) compress4Xp(src []byte) ([]byte, error) { // Does not update s.clearCount. func (s *Scratch) countSimple(in []byte) (max int, reuse bool) { reuse = true + _ = s.count // Assert that s != nil to speed up the following loop. for _, v := range in { s.count[v]++ } @@ -415,7 +416,7 @@ func (s *Scratch) validateTable(c cTable) bool { // minTableLog provides the minimum logSize to safely represent a distribution. func (s *Scratch) minTableLog() uint8 { - minBitsSrc := highBit32(uint32(s.br.remain())) + 1 + minBitsSrc := highBit32(uint32(s.srcLen)) + 1 minBitsSymbols := highBit32(uint32(s.symbolLen-1)) + 2 if minBitsSrc < minBitsSymbols { return uint8(minBitsSrc) @@ -427,7 +428,7 @@ func (s *Scratch) minTableLog() uint8 { func (s *Scratch) optimalTableLog() { tableLog := s.TableLog minBits := s.minTableLog() - maxBitsSrc := uint8(highBit32(uint32(s.br.remain()-1))) - 1 + maxBitsSrc := uint8(highBit32(uint32(s.srcLen-1))) - 1 if maxBitsSrc < tableLog { // Accuracy can be reduced tableLog = maxBitsSrc diff --git a/vendor/github.com/klauspost/compress/huff0/huff0.go b/vendor/github.com/klauspost/compress/huff0/huff0.go index e8ad17ad0..77ecd68e0 100644 --- a/vendor/github.com/klauspost/compress/huff0/huff0.go +++ b/vendor/github.com/klauspost/compress/huff0/huff0.go @@ -88,7 +88,7 @@ type Scratch struct { // Decoders will return ErrMaxDecodedSizeExceeded is this limit is exceeded. MaxDecodedSize int - br byteReader + srcLen int // MaxSymbolValue will override the maximum symbol value of the next block. MaxSymbolValue uint8 @@ -170,7 +170,7 @@ func (s *Scratch) prepare(in []byte) (*Scratch, error) { if s.fse == nil { s.fse = &fse.Scratch{} } - s.br.init(in) + s.srcLen = len(in) return s, nil } diff --git a/vendor/github.com/klauspost/compress/s2/encode.go b/vendor/github.com/klauspost/compress/s2/encode.go index e6c231021..0c9088adf 100644 --- a/vendor/github.com/klauspost/compress/s2/encode.go +++ b/vendor/github.com/klauspost/compress/s2/encode.go @@ -57,7 +57,7 @@ func Encode(dst, src []byte) []byte { // The function returns -1 if no improvement could be achieved. // Using actual compression will most often produce better compression than the estimate. func EstimateBlockSize(src []byte) (d int) { - if len(src) < 6 || int64(len(src)) > 0xffffffff { + if len(src) <= inputMargin || int64(len(src)) > 0xffffffff { return -1 } if len(src) <= 1024 { diff --git a/vendor/github.com/klauspost/compress/s2/encode_best.go b/vendor/github.com/klauspost/compress/s2/encode_best.go index 1d13e869a..47bac7423 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_best.go +++ b/vendor/github.com/klauspost/compress/s2/encode_best.go @@ -157,6 +157,9 @@ func encodeBlockBest(dst, src []byte, dict *Dict) (d int) { return m } matchDict := func(candidate, s int, first uint32, rep bool) match { + if s >= MaxDictSrcOffset { + return match{offset: candidate, s: s} + } // Calculate offset as if in continuous array with s offset := -len(dict.dict) + candidate if best.length != 0 && best.s-best.offset == s-offset && !rep { diff --git a/vendor/github.com/klauspost/compress/s2/encode_go.go b/vendor/github.com/klauspost/compress/s2/encode_go.go index 0d39c7b0e..6b393c34d 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_go.go +++ b/vendor/github.com/klauspost/compress/s2/encode_go.go @@ -316,6 +316,7 @@ func matchLen(a []byte, b []byte) int { return len(a) + checked } +// input must be > inputMargin func calcBlockSize(src []byte) (d int) { // Initialize the hash table. const ( @@ -501,6 +502,7 @@ emitRemainder: return d } +// length must be > inputMargin. func calcBlockSizeSmall(src []byte) (d int) { // Initialize the hash table. const ( diff --git a/vendor/github.com/klauspost/compress/zstd/README.md b/vendor/github.com/klauspost/compress/zstd/README.md index bdd49c8b2..92e2347bb 100644 --- a/vendor/github.com/klauspost/compress/zstd/README.md +++ b/vendor/github.com/klauspost/compress/zstd/README.md @@ -259,7 +259,7 @@ nyc-taxi-data-10M.csv gzkp 1 3325605752 922273214 13929 227.68 ## Decompressor -Staus: STABLE - there may still be subtle bugs, but a wide variety of content has been tested. +Status: STABLE - there may still be subtle bugs, but a wide variety of content has been tested. This library is being continuously [fuzz-tested](https://github.com/klauspost/compress-fuzz), kindly supplied by [fuzzit.dev](https://fuzzit.dev/). diff --git a/vendor/github.com/klauspost/compress/zstd/enc_best.go b/vendor/github.com/klauspost/compress/zstd/enc_best.go index 9819d4145..c81a15357 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_best.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_best.go @@ -43,7 +43,7 @@ func (m *match) estBits(bitsPerByte int32) { if m.rep < 0 { ofc = ofCode(uint32(m.s-m.offset) + 3) } else { - ofc = ofCode(uint32(m.rep)) + ofc = ofCode(uint32(m.rep) & 3) } // Cost, excluding ofTT, mlTT := fsePredefEnc[tableOffsets].ct.symbolTT[ofc], fsePredefEnc[tableMatchLengths].ct.symbolTT[mlc] @@ -197,12 +197,13 @@ encodeLoop: // Set m to a match at offset if it looks like that will improve compression. improve := func(m *match, offset int32, s int32, first uint32, rep int32) { - if s-offset >= e.maxMatchOff || load3232(src, offset) != first { + delta := s - offset + if delta >= e.maxMatchOff || delta <= 0 || load3232(src, offset) != first { return } if debugAsserts { - if offset <= 0 { - panic(offset) + if offset >= s { + panic(fmt.Sprintf("offset: %d - s:%d - rep: %d - cur :%d - max: %d", offset, s, rep, e.cur, e.maxMatchOff)) } if !bytes.Equal(src[s:s+4], src[offset:offset+4]) { panic(fmt.Sprintf("first match mismatch: %v != %v, first: %08x", src[s:s+4], src[offset:offset+4], first)) @@ -226,7 +227,7 @@ encodeLoop: } } l := 4 + e.matchlen(s+4, offset+4, src) - if rep < 0 { + if true { // Extend candidate match backwards as far as possible. tMin := s - e.maxMatchOff if tMin < 0 { @@ -281,6 +282,7 @@ encodeLoop: // Load next and check... e.longTable[nextHashL] = prevEntry{offset: s + e.cur, prev: candidateL.offset} e.table[nextHashS] = prevEntry{offset: s + e.cur, prev: candidateS.offset} + index0 := s + 1 // Look far ahead, unless we have a really long match already... if best.length < goodEnough { @@ -343,8 +345,8 @@ encodeLoop: if best.rep > 0 { var seq seq seq.matchLen = uint32(best.length - zstdMinMatch) - if debugAsserts && s <= nextEmit { - panic("s <= nextEmit") + if debugAsserts && s < nextEmit { + panic("s < nextEmit") } addLiterals(&seq, best.s) @@ -356,19 +358,16 @@ encodeLoop: blk.sequences = append(blk.sequences, seq) // Index old s + 1 -> s - 1 - index0 := s + 1 s = best.s + best.length - nextEmit = s - if s >= sLimit { - if debugEncoder { - println("repeat ended", s, best.length) - } - break encodeLoop - } + // Index skipped... + end := s + if s > sLimit+4 { + end = sLimit + 4 + } off := index0 + e.cur - for index0 < s { + for index0 < end { cv0 := load6432(src, index0) h0 := hashLen(cv0, bestLongTableBits, bestLongLen) h1 := hashLen(cv0, bestShortTableBits, bestShortLen) @@ -377,6 +376,7 @@ encodeLoop: off++ index0++ } + switch best.rep { case 2, 4 | 1: offset1, offset2 = offset2, offset1 @@ -385,12 +385,17 @@ encodeLoop: case 4 | 3: offset1, offset2, offset3 = offset1-1, offset1, offset2 } + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, best.length) + } + break encodeLoop + } continue } // A 4-byte match has been found. Update recent offsets. // We'll later see if more than 4 bytes. - index0 := s + 1 s = best.s t := best.offset offset1, offset2, offset3 = s-t, offset1, offset2 @@ -418,19 +423,25 @@ encodeLoop: } blk.sequences = append(blk.sequences, seq) nextEmit = s - if s >= sLimit { - break encodeLoop + + // Index old s + 1 -> s - 1 or sLimit + end := s + if s > sLimit-4 { + end = sLimit - 4 } - // Index old s + 1 -> s - 1 - for index0 < s { + off := index0 + e.cur + for index0 < end { cv0 := load6432(src, index0) h0 := hashLen(cv0, bestLongTableBits, bestLongLen) h1 := hashLen(cv0, bestShortTableBits, bestShortLen) - off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.table[h1] = prevEntry{offset: off, prev: e.table[h1].offset} index0++ + off++ + } + if s >= sLimit { + break encodeLoop } } diff --git a/vendor/github.com/klauspost/compress/zstd/enc_better.go b/vendor/github.com/klauspost/compress/zstd/enc_better.go index 8582f31a7..20d25b0e0 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_better.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_better.go @@ -145,7 +145,7 @@ encodeLoop: var t int32 // We allow the encoder to optionally turn off repeat offsets across blocks canRepeat := len(blk.sequences) > 2 - var matched int32 + var matched, index0 int32 for { if debugAsserts && canRepeat && offset1 == 0 { @@ -162,6 +162,7 @@ encodeLoop: off := s + e.cur e.longTable[nextHashL] = prevEntry{offset: off, prev: candidateL.offset} e.table[nextHashS] = tableEntry{offset: off, val: uint32(cv)} + index0 = s + 1 if canRepeat { if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) { @@ -258,7 +259,6 @@ encodeLoop: } blk.sequences = append(blk.sequences, seq) - index0 := s + repOff2 s += lenght + repOff2 nextEmit = s if s >= sLimit { @@ -498,15 +498,15 @@ encodeLoop: } // Index match start+1 (long) -> s - 1 - index0 := s - l + 1 + off := index0 + e.cur for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 h0 := hashLen(cv0, betterLongTableBits, betterLongLen) - off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} index0 += 2 + off += 2 } cv = load6432(src, s) @@ -672,7 +672,7 @@ encodeLoop: var t int32 // We allow the encoder to optionally turn off repeat offsets across blocks canRepeat := len(blk.sequences) > 2 - var matched int32 + var matched, index0 int32 for { if debugAsserts && canRepeat && offset1 == 0 { @@ -691,6 +691,7 @@ encodeLoop: e.markLongShardDirty(nextHashL) e.table[nextHashS] = tableEntry{offset: off, val: uint32(cv)} e.markShortShardDirty(nextHashS) + index0 = s + 1 if canRepeat { if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) { @@ -726,7 +727,6 @@ encodeLoop: blk.sequences = append(blk.sequences, seq) // Index match start+1 (long) -> s - 1 - index0 := s + repOff s += lenght + repOff nextEmit = s @@ -790,7 +790,6 @@ encodeLoop: } blk.sequences = append(blk.sequences, seq) - index0 := s + repOff2 s += lenght + repOff2 nextEmit = s if s >= sLimit { @@ -1024,18 +1023,18 @@ encodeLoop: } // Index match start+1 (long) -> s - 1 - index0 := s - l + 1 + off := index0 + e.cur for index0 < s-1 { cv0 := load6432(src, index0) cv1 := cv0 >> 8 h0 := hashLen(cv0, betterLongTableBits, betterLongLen) - off := index0 + e.cur e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} e.markLongShardDirty(h0) h1 := hashLen(cv1, betterShortTableBits, betterShortLen) e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} e.markShortShardDirty(h1) index0 += 2 + off += 2 } cv = load6432(src, s) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index accd7abaf..30f8d2963 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c Package home: https://github.com/klauspost/cpuid [![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2) -[![Build Status][3]][4] - -[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master -[4]: https://travis-ci.org/klauspost/cpuid +[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml) ## installing @@ -285,7 +282,12 @@ Exit Code 1 | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | | AMXTILE | Tile architecture | +| APX_F | Intel APX | | AVX | AVX functions | +| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | +| AVX10_128 | If set indicates that AVX10 128-bit vector support is present | +| AVX10_256 | If set indicates that AVX10 256-bit vector support is present | +| AVX10_512 | If set indicates that AVX10 512-bit vector support is present | | AVX2 | AVX2 functions | | AVX512BF16 | AVX-512 BFLOAT16 Instructions | | AVX512BITALG | AVX-512 Bit Algorithms | @@ -365,6 +367,8 @@ Exit Code 1 | IDPRED_CTRL | IPRED_DIS | | INT_WBINVD | WBINVD/WBNOINVD are interruptible. | | INVLPGB | NVLPGB and TLBSYNC instruction supported | +| KEYLOCKER | Key locker | +| KEYLOCKERW | Key locker wide | | LAHF | LAHF/SAHF in long mode | | LAM | If set, CPU supports Linear Address Masking | | LBRVIRT | LBR virtualization | @@ -380,7 +384,7 @@ Exit Code 1 | MOVDIRI | Move Doubleword as Direct Store | | MOVSB_ZL | Fast Zero-Length MOVSB | | MPX | Intel MPX (Memory Protection Extensions) | -| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | | MSRIRC | Instruction Retired Counter MSR available | | MSRLIST | Read/Write List of Model Specific Registers | | MSR_PAGEFLUSH | Page Flush MSR available | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index d015c744e..15b760337 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -76,7 +76,12 @@ const ( AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers AMXTILE // Tile architecture + APX_F // Intel APX AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present AVX2 // AVX2 functions AVX512BF16 // AVX-512 BFLOAT16 Instructions AVX512BITALG // AVX-512 Bit Algorithms @@ -156,6 +161,8 @@ const ( IDPRED_CTRL // IPRED_DIS INT_WBINVD // WBINVD/WBNOINVD are interruptible. INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide LAHF // LAHF/SAHF in long mode LAM // If set, CPU supports Linear Address Masking LBRVIRT // LBR virtualization @@ -302,9 +309,10 @@ type CPUInfo struct { L2 int // L2 Cache (per core or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected } - SGX SGXSupport - maxFunc uint32 - maxExFunc uint32 + SGX SGXSupport + AVX10Level uint8 + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -1165,6 +1173,7 @@ func support() flagSet { fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<23) != 0, KEYLOCKER) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) @@ -1202,6 +1211,8 @@ func support() flagSet { fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + fs.setIf(edx1&(1<<19) != 0, AVX10) + fs.setIf(edx1&(1<<21) != 0, APX_F) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -1252,6 +1263,19 @@ func support() flagSet { fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<5) != 0, MCDT_NO) + // Add keylocker features. + if fs.inSet(KEYLOCKER) && mfi >= 0x19 { + _, ebx, _, _ := cpuidex(0x19, 0) + fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4) + } + + // Add AVX10 features. + if fs.inSet(AVX10) && mfi >= 0x24 { + _, ebx, _, _ := cpuidex(0x24, 0) + fs.setIf(ebx&(1<<16) != 0, AVX10_128) + fs.setIf(ebx&(1<<17) != 0, AVX10_256) + fs.setIf(ebx&(1<<18) != 0, AVX10_512) + } } // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) @@ -1394,6 +1418,20 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if mfi >= 0x20 { + // Microsoft has decided to purposefully hide the information + // of the guest TEE when VMs are being created using Hyper-V. + // + // This leads us to check for the Hyper-V cpuid features + // (0x4000000C), and then for the `ebx` value set. + // + // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part + // we're mostly interested about,according to: + // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174 + _, ebx, _, _ := cpuid(0x4000000C) + fs.setIf(ebx == 0xbe3, TDX_GUEST) + } + if mfi >= 0x21 { // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). _, ebx, ecx, edx := cpuid(0x21) @@ -1404,6 +1442,14 @@ func support() flagSet { return fs } +func (c *CPUInfo) supportAVX10() uint8 { + if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) { + _, ebx, _, _ := cpuidex(0x24, 0) + return uint8(ebx) + } + return 0 +} + func valAsString(values ...uint32) []byte { r := make([]byte, 4*len(values)) for i, v := range values { diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index c946824ec..c7dfa125d 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -31,6 +31,7 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 024c706af..43bd05f51 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -16,210 +16,217 @@ func _() { _ = x[AMXFP16-6] _ = x[AMXINT8-7] _ = x[AMXTILE-8] - _ = x[AVX-9] - _ = x[AVX2-10] - _ = x[AVX512BF16-11] - _ = x[AVX512BITALG-12] - _ = x[AVX512BW-13] - _ = x[AVX512CD-14] - _ = x[AVX512DQ-15] - _ = x[AVX512ER-16] - _ = x[AVX512F-17] - _ = x[AVX512FP16-18] - _ = x[AVX512IFMA-19] - _ = x[AVX512PF-20] - _ = x[AVX512VBMI-21] - _ = x[AVX512VBMI2-22] - _ = x[AVX512VL-23] - _ = x[AVX512VNNI-24] - _ = x[AVX512VP2INTERSECT-25] - _ = x[AVX512VPOPCNTDQ-26] - _ = x[AVXIFMA-27] - _ = x[AVXNECONVERT-28] - _ = x[AVXSLOW-29] - _ = x[AVXVNNI-30] - _ = x[AVXVNNIINT8-31] - _ = x[BHI_CTRL-32] - _ = x[BMI1-33] - _ = x[BMI2-34] - _ = x[CETIBT-35] - _ = x[CETSS-36] - _ = x[CLDEMOTE-37] - _ = x[CLMUL-38] - _ = x[CLZERO-39] - _ = x[CMOV-40] - _ = x[CMPCCXADD-41] - _ = x[CMPSB_SCADBS_SHORT-42] - _ = x[CMPXCHG8-43] - _ = x[CPBOOST-44] - _ = x[CPPC-45] - _ = x[CX16-46] - _ = x[EFER_LMSLE_UNS-47] - _ = x[ENQCMD-48] - _ = x[ERMS-49] - _ = x[F16C-50] - _ = x[FLUSH_L1D-51] - _ = x[FMA3-52] - _ = x[FMA4-53] - _ = x[FP128-54] - _ = x[FP256-55] - _ = x[FSRM-56] - _ = x[FXSR-57] - _ = x[FXSROPT-58] - _ = x[GFNI-59] - _ = x[HLE-60] - _ = x[HRESET-61] - _ = x[HTT-62] - _ = x[HWA-63] - _ = x[HYBRID_CPU-64] - _ = x[HYPERVISOR-65] - _ = x[IA32_ARCH_CAP-66] - _ = x[IA32_CORE_CAP-67] - _ = x[IBPB-68] - _ = x[IBRS-69] - _ = x[IBRS_PREFERRED-70] - _ = x[IBRS_PROVIDES_SMP-71] - _ = x[IBS-72] - _ = x[IBSBRNTRGT-73] - _ = x[IBSFETCHSAM-74] - _ = x[IBSFFV-75] - _ = x[IBSOPCNT-76] - _ = x[IBSOPCNTEXT-77] - _ = x[IBSOPSAM-78] - _ = x[IBSRDWROPCNT-79] - _ = x[IBSRIPINVALIDCHK-80] - _ = x[IBS_FETCH_CTLX-81] - _ = x[IBS_OPDATA4-82] - _ = x[IBS_OPFUSE-83] - _ = x[IBS_PREVENTHOST-84] - _ = x[IBS_ZEN4-85] - _ = x[IDPRED_CTRL-86] - _ = x[INT_WBINVD-87] - _ = x[INVLPGB-88] - _ = x[LAHF-89] - _ = x[LAM-90] - _ = x[LBRVIRT-91] - _ = x[LZCNT-92] - _ = x[MCAOVERFLOW-93] - _ = x[MCDT_NO-94] - _ = x[MCOMMIT-95] - _ = x[MD_CLEAR-96] - _ = x[MMX-97] - _ = x[MMXEXT-98] - _ = x[MOVBE-99] - _ = x[MOVDIR64B-100] - _ = x[MOVDIRI-101] - _ = x[MOVSB_ZL-102] - _ = x[MOVU-103] - _ = x[MPX-104] - _ = x[MSRIRC-105] - _ = x[MSRLIST-106] - _ = x[MSR_PAGEFLUSH-107] - _ = x[NRIPS-108] - _ = x[NX-109] - _ = x[OSXSAVE-110] - _ = x[PCONFIG-111] - _ = x[POPCNT-112] - _ = x[PPIN-113] - _ = x[PREFETCHI-114] - _ = x[PSFD-115] - _ = x[RDPRU-116] - _ = x[RDRAND-117] - _ = x[RDSEED-118] - _ = x[RDTSCP-119] - _ = x[RRSBA_CTRL-120] - _ = x[RTM-121] - _ = x[RTM_ALWAYS_ABORT-122] - _ = x[SERIALIZE-123] - _ = x[SEV-124] - _ = x[SEV_64BIT-125] - _ = x[SEV_ALTERNATIVE-126] - _ = x[SEV_DEBUGSWAP-127] - _ = x[SEV_ES-128] - _ = x[SEV_RESTRICTED-129] - _ = x[SEV_SNP-130] - _ = x[SGX-131] - _ = x[SGXLC-132] - _ = x[SHA-133] - _ = x[SME-134] - _ = x[SME_COHERENT-135] - _ = x[SPEC_CTRL_SSBD-136] - _ = x[SRBDS_CTRL-137] - _ = x[SSE-138] - _ = x[SSE2-139] - _ = x[SSE3-140] - _ = x[SSE4-141] - _ = x[SSE42-142] - _ = x[SSE4A-143] - _ = x[SSSE3-144] - _ = x[STIBP-145] - _ = x[STIBP_ALWAYSON-146] - _ = x[STOSB_SHORT-147] - _ = x[SUCCOR-148] - _ = x[SVM-149] - _ = x[SVMDA-150] - _ = x[SVMFBASID-151] - _ = x[SVML-152] - _ = x[SVMNP-153] - _ = x[SVMPF-154] - _ = x[SVMPFT-155] - _ = x[SYSCALL-156] - _ = x[SYSEE-157] - _ = x[TBM-158] - _ = x[TDX_GUEST-159] - _ = x[TLB_FLUSH_NESTED-160] - _ = x[TME-161] - _ = x[TOPEXT-162] - _ = x[TSCRATEMSR-163] - _ = x[TSXLDTRK-164] - _ = x[VAES-165] - _ = x[VMCBCLEAN-166] - _ = x[VMPL-167] - _ = x[VMSA_REGPROT-168] - _ = x[VMX-169] - _ = x[VPCLMULQDQ-170] - _ = x[VTE-171] - _ = x[WAITPKG-172] - _ = x[WBNOINVD-173] - _ = x[WRMSRNS-174] - _ = x[X87-175] - _ = x[XGETBV1-176] - _ = x[XOP-177] - _ = x[XSAVE-178] - _ = x[XSAVEC-179] - _ = x[XSAVEOPT-180] - _ = x[XSAVES-181] - _ = x[AESARM-182] - _ = x[ARMCPUID-183] - _ = x[ASIMD-184] - _ = x[ASIMDDP-185] - _ = x[ASIMDHP-186] - _ = x[ASIMDRDM-187] - _ = x[ATOMICS-188] - _ = x[CRC32-189] - _ = x[DCPOP-190] - _ = x[EVTSTRM-191] - _ = x[FCMA-192] - _ = x[FP-193] - _ = x[FPHP-194] - _ = x[GPA-195] - _ = x[JSCVT-196] - _ = x[LRCPC-197] - _ = x[PMULL-198] - _ = x[SHA1-199] - _ = x[SHA2-200] - _ = x[SHA3-201] - _ = x[SHA512-202] - _ = x[SM3-203] - _ = x[SM4-204] - _ = x[SVE-205] - _ = x[lastID-206] + _ = x[APX_F-9] + _ = x[AVX-10] + _ = x[AVX10-11] + _ = x[AVX10_128-12] + _ = x[AVX10_256-13] + _ = x[AVX10_512-14] + _ = x[AVX2-15] + _ = x[AVX512BF16-16] + _ = x[AVX512BITALG-17] + _ = x[AVX512BW-18] + _ = x[AVX512CD-19] + _ = x[AVX512DQ-20] + _ = x[AVX512ER-21] + _ = x[AVX512F-22] + _ = x[AVX512FP16-23] + _ = x[AVX512IFMA-24] + _ = x[AVX512PF-25] + _ = x[AVX512VBMI-26] + _ = x[AVX512VBMI2-27] + _ = x[AVX512VL-28] + _ = x[AVX512VNNI-29] + _ = x[AVX512VP2INTERSECT-30] + _ = x[AVX512VPOPCNTDQ-31] + _ = x[AVXIFMA-32] + _ = x[AVXNECONVERT-33] + _ = x[AVXSLOW-34] + _ = x[AVXVNNI-35] + _ = x[AVXVNNIINT8-36] + _ = x[BHI_CTRL-37] + _ = x[BMI1-38] + _ = x[BMI2-39] + _ = x[CETIBT-40] + _ = x[CETSS-41] + _ = x[CLDEMOTE-42] + _ = x[CLMUL-43] + _ = x[CLZERO-44] + _ = x[CMOV-45] + _ = x[CMPCCXADD-46] + _ = x[CMPSB_SCADBS_SHORT-47] + _ = x[CMPXCHG8-48] + _ = x[CPBOOST-49] + _ = x[CPPC-50] + _ = x[CX16-51] + _ = x[EFER_LMSLE_UNS-52] + _ = x[ENQCMD-53] + _ = x[ERMS-54] + _ = x[F16C-55] + _ = x[FLUSH_L1D-56] + _ = x[FMA3-57] + _ = x[FMA4-58] + _ = x[FP128-59] + _ = x[FP256-60] + _ = x[FSRM-61] + _ = x[FXSR-62] + _ = x[FXSROPT-63] + _ = x[GFNI-64] + _ = x[HLE-65] + _ = x[HRESET-66] + _ = x[HTT-67] + _ = x[HWA-68] + _ = x[HYBRID_CPU-69] + _ = x[HYPERVISOR-70] + _ = x[IA32_ARCH_CAP-71] + _ = x[IA32_CORE_CAP-72] + _ = x[IBPB-73] + _ = x[IBRS-74] + _ = x[IBRS_PREFERRED-75] + _ = x[IBRS_PROVIDES_SMP-76] + _ = x[IBS-77] + _ = x[IBSBRNTRGT-78] + _ = x[IBSFETCHSAM-79] + _ = x[IBSFFV-80] + _ = x[IBSOPCNT-81] + _ = x[IBSOPCNTEXT-82] + _ = x[IBSOPSAM-83] + _ = x[IBSRDWROPCNT-84] + _ = x[IBSRIPINVALIDCHK-85] + _ = x[IBS_FETCH_CTLX-86] + _ = x[IBS_OPDATA4-87] + _ = x[IBS_OPFUSE-88] + _ = x[IBS_PREVENTHOST-89] + _ = x[IBS_ZEN4-90] + _ = x[IDPRED_CTRL-91] + _ = x[INT_WBINVD-92] + _ = x[INVLPGB-93] + _ = x[KEYLOCKER-94] + _ = x[KEYLOCKERW-95] + _ = x[LAHF-96] + _ = x[LAM-97] + _ = x[LBRVIRT-98] + _ = x[LZCNT-99] + _ = x[MCAOVERFLOW-100] + _ = x[MCDT_NO-101] + _ = x[MCOMMIT-102] + _ = x[MD_CLEAR-103] + _ = x[MMX-104] + _ = x[MMXEXT-105] + _ = x[MOVBE-106] + _ = x[MOVDIR64B-107] + _ = x[MOVDIRI-108] + _ = x[MOVSB_ZL-109] + _ = x[MOVU-110] + _ = x[MPX-111] + _ = x[MSRIRC-112] + _ = x[MSRLIST-113] + _ = x[MSR_PAGEFLUSH-114] + _ = x[NRIPS-115] + _ = x[NX-116] + _ = x[OSXSAVE-117] + _ = x[PCONFIG-118] + _ = x[POPCNT-119] + _ = x[PPIN-120] + _ = x[PREFETCHI-121] + _ = x[PSFD-122] + _ = x[RDPRU-123] + _ = x[RDRAND-124] + _ = x[RDSEED-125] + _ = x[RDTSCP-126] + _ = x[RRSBA_CTRL-127] + _ = x[RTM-128] + _ = x[RTM_ALWAYS_ABORT-129] + _ = x[SERIALIZE-130] + _ = x[SEV-131] + _ = x[SEV_64BIT-132] + _ = x[SEV_ALTERNATIVE-133] + _ = x[SEV_DEBUGSWAP-134] + _ = x[SEV_ES-135] + _ = x[SEV_RESTRICTED-136] + _ = x[SEV_SNP-137] + _ = x[SGX-138] + _ = x[SGXLC-139] + _ = x[SHA-140] + _ = x[SME-141] + _ = x[SME_COHERENT-142] + _ = x[SPEC_CTRL_SSBD-143] + _ = x[SRBDS_CTRL-144] + _ = x[SSE-145] + _ = x[SSE2-146] + _ = x[SSE3-147] + _ = x[SSE4-148] + _ = x[SSE42-149] + _ = x[SSE4A-150] + _ = x[SSSE3-151] + _ = x[STIBP-152] + _ = x[STIBP_ALWAYSON-153] + _ = x[STOSB_SHORT-154] + _ = x[SUCCOR-155] + _ = x[SVM-156] + _ = x[SVMDA-157] + _ = x[SVMFBASID-158] + _ = x[SVML-159] + _ = x[SVMNP-160] + _ = x[SVMPF-161] + _ = x[SVMPFT-162] + _ = x[SYSCALL-163] + _ = x[SYSEE-164] + _ = x[TBM-165] + _ = x[TDX_GUEST-166] + _ = x[TLB_FLUSH_NESTED-167] + _ = x[TME-168] + _ = x[TOPEXT-169] + _ = x[TSCRATEMSR-170] + _ = x[TSXLDTRK-171] + _ = x[VAES-172] + _ = x[VMCBCLEAN-173] + _ = x[VMPL-174] + _ = x[VMSA_REGPROT-175] + _ = x[VMX-176] + _ = x[VPCLMULQDQ-177] + _ = x[VTE-178] + _ = x[WAITPKG-179] + _ = x[WBNOINVD-180] + _ = x[WRMSRNS-181] + _ = x[X87-182] + _ = x[XGETBV1-183] + _ = x[XOP-184] + _ = x[XSAVE-185] + _ = x[XSAVEC-186] + _ = x[XSAVEOPT-187] + _ = x[XSAVES-188] + _ = x[AESARM-189] + _ = x[ARMCPUID-190] + _ = x[ASIMD-191] + _ = x[ASIMDDP-192] + _ = x[ASIMDHP-193] + _ = x[ASIMDRDM-194] + _ = x[ATOMICS-195] + _ = x[CRC32-196] + _ = x[DCPOP-197] + _ = x[EVTSTRM-198] + _ = x[FCMA-199] + _ = x[FP-200] + _ = x[FPHP-201] + _ = x[GPA-202] + _ = x[JSCVT-203] + _ = x[LRCPC-204] + _ = x[PMULL-205] + _ = x[SHA1-206] + _ = x[SHA2-207] + _ = x[SHA3-208] + _ = x[SHA512-209] + _ = x[SM3-210] + _ = x[SM4-211] + _ = x[SVE-212] + _ = x[lastID-213] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/minio/minio-go/v7/README.md b/vendor/github.com/minio/minio-go/v7/README.md index 9b6bbbec3..82f70a131 100644 --- a/vendor/github.com/minio/minio-go/v7/README.md +++ b/vendor/github.com/minio/minio-go/v7/README.md @@ -1,23 +1,28 @@ # MinIO Go Client SDK for Amazon S3 Compatible Cloud Storage [![Slack](https://slack.min.io/slack?type=svg)](https://slack.min.io) [![Sourcegraph](https://sourcegraph.com/github.com/minio/minio-go/-/badge.svg)](https://sourcegraph.com/github.com/minio/minio-go?badge) [![Apache V2 License](https://img.shields.io/badge/license-Apache%20V2-blue.svg)](https://github.com/minio/minio-go/blob/master/LICENSE) -The MinIO Go Client SDK provides simple APIs to access any Amazon S3 compatible object storage. +The MinIO Go Client SDK provides straightforward APIs to access any Amazon S3 compatible object storage. -This quickstart guide will show you how to install the MinIO client SDK, connect to MinIO, and provide a walkthrough for a simple file uploader. For a complete list of APIs and examples, please take a look at the [Go Client API Reference](https://min.io/docs/minio/linux/developers/go/API.html). +This Quickstart Guide covers how to install the MinIO client SDK, connect to MinIO, and create a sample file uploader. +For a complete list of APIs and examples, see the [godoc documentation](https://pkg.go.dev/github.com/minio/minio-go/v7) or [Go Client API Reference](https://min.io/docs/minio/linux/developers/go/API.html). -This document assumes that you have a working [Go development environment](https://golang.org/doc/install). +These examples presume a working [Go development environment](https://golang.org/doc/install) and the [MinIO `mc` command line tool](https://min.io/docs/minio/linux/reference/minio-mc.html). ## Download from Github + +From your project directory: + ```sh go get github.com/minio/minio-go/v7 ``` -## Initialize MinIO Client -MinIO client requires the following four parameters specified to connect to an Amazon S3 compatible object storage. +## Initialize a MinIO Client Object + +The MinIO client requires the following parameters to connect to an Amazon S3 compatible object storage: -| Parameter | Description| -| :--- | :--- | -| endpoint | URL to object storage service. | -| _minio.Options_ | All the options such as credentials, custom transport etc. | +| Parameter | Description | +| ----------------- | ---------------------------------------------------------- | +| `endpoint` | URL to object storage service. | +| `_minio.Options_` | All the options such as credentials, custom transport etc. | ```go package main @@ -48,13 +53,25 @@ func main() { } ``` -## Quick Start Example - File Uploader -This example program connects to an object storage server, creates a bucket and uploads a file to the bucket. +## Example - File Uploader -We will use the MinIO server running at [https://play.min.io](https://play.min.io) in this example. Feel free to use this service for testing and development. Access credentials shown in this example are open to the public. +This sample code connects to an object storage server, creates a bucket, and uploads a file to the bucket. +It uses the MinIO `play` server, a public MinIO cluster located at [https://play.min.io](https://play.min.io). + +The `play` server runs the latest stable version of MinIO and may be used for testing and development. +The access credentials shown in this example are open to the public and all data uploaded to `play` should be considered public and non-protected. ### FileUploader.go + +This example does the following: + +- Connects to the MinIO `play` server using the provided credentials. +- Creates a bucket named `testbucket`. +- Uploads a file named `testdata` from `/tmp`. +- Verifies the file was created using `mc ls`. + ```go +// FileUploader.go MinIO example package main import ( @@ -81,8 +98,8 @@ func main() { log.Fatalln(err) } - // Make a new bucket called mymusic. - bucketName := "mymusic" + // Make a new bucket called testbucket. + bucketName := "testbucket" location := "us-east-1" err = minioClient.MakeBucket(ctx, bucketName, minio.MakeBucketOptions{Region: location}) @@ -98,12 +115,13 @@ func main() { log.Printf("Successfully created %s\n", bucketName) } - // Upload the zip file - objectName := "golden-oldies.zip" - filePath := "/tmp/golden-oldies.zip" - contentType := "application/zip" + // Upload the test file + // Change the value of filePath if the file is in another location + objectName := "testdata" + filePath := "/tmp/testdata" + contentType := "application/octet-stream" - // Upload the zip file with FPutObject + // Upload the test file with FPutObject info, err := minioClient.FPutObject(ctx, bucketName, objectName, filePath, minio.PutObjectOptions{ContentType: contentType}) if err != nil { log.Fatalln(err) @@ -113,22 +131,51 @@ func main() { } ``` -### Run FileUploader +**1. Create a test file containing data:** + +You can do this with `dd` on Linux or macOS systems: + +```sh +dd if=/dev/urandom of=/tmp/testdata bs=2048 count=10 +``` + +or `fsutil` on Windows: + +```sh +fsutil file createnew "C:\Users\\Desktop\sample.txt" 20480 +``` + +**2. Run FileUploader with the following commands:** + ```sh -go run file-uploader.go -2016/08/13 17:03:28 Successfully created mymusic -2016/08/13 17:03:40 Successfully uploaded golden-oldies.zip of size 16253413 +go mod init example/FileUploader +go get github.com/minio/minio-go/v7 +go get github.com/minio/minio-go/v7/pkg/credentials +go run FileUploader.go +``` + +The output resembles the following: -mc ls play/mymusic/ -[2016-05-27 16:02:16 PDT] 17MiB golden-oldies.zip +```sh +2023/11/01 14:27:55 Successfully created testbucket +2023/11/01 14:27:55 Successfully uploaded testdata of size 20480 +``` + +**3. Verify the Uploaded File With `mc ls`:** + +```sh +mc ls play/testbucket +[2023-11-01 14:27:55 UTC] 20KiB STANDARD TestDataFile ``` ## API Reference + The full API Reference is available here. * [Complete API Reference](https://min.io/docs/minio/linux/developers/go/API.html) ### API Reference : Bucket Operations + * [`MakeBucket`](https://min.io/docs/minio/linux/developers/go/API.html#MakeBucket) * [`ListBuckets`](https://min.io/docs/minio/linux/developers/go/API.html#ListBuckets) * [`BucketExists`](https://min.io/docs/minio/linux/developers/go/API.html#BucketExists) @@ -137,10 +184,12 @@ The full API Reference is available here. * [`ListIncompleteUploads`](https://min.io/docs/minio/linux/developers/go/API.html#ListIncompleteUploads) ### API Reference : Bucket policy Operations + * [`SetBucketPolicy`](https://min.io/docs/minio/linux/developers/go/API.html#SetBucketPolicy) * [`GetBucketPolicy`](https://min.io/docs/minio/linux/developers/go/API.html#GetBucketPolicy) ### API Reference : Bucket notification Operations + * [`SetBucketNotification`](https://min.io/docs/minio/linux/developers/go/API.html#SetBucketNotification) * [`GetBucketNotification`](https://min.io/docs/minio/linux/developers/go/API.html#GetBucketNotification) * [`RemoveAllBucketNotification`](https://min.io/docs/minio/linux/developers/go/API.html#RemoveAllBucketNotification) @@ -148,10 +197,12 @@ The full API Reference is available here. * [`ListenNotification`](https://min.io/docs/minio/linux/developers/go/API.html#ListenNotification) (MinIO Extension) ### API Reference : File Object Operations + * [`FPutObject`](https://min.io/docs/minio/linux/developers/go/API.html#FPutObject) * [`FGetObject`](https://min.io/docs/minio/linux/developers/go/API.html#FGetObject) ### API Reference : Object Operations + * [`GetObject`](https://min.io/docs/minio/linux/developers/go/API.html#GetObject) * [`PutObject`](https://min.io/docs/minio/linux/developers/go/API.html#PutObject) * [`PutObjectStreaming`](https://min.io/docs/minio/linux/developers/go/API.html#PutObjectStreaming) @@ -162,14 +213,15 @@ The full API Reference is available here. * [`RemoveIncompleteUpload`](https://min.io/docs/minio/linux/developers/go/API.html#RemoveIncompleteUpload) * [`SelectObjectContent`](https://min.io/docs/minio/linux/developers/go/API.html#SelectObjectContent) - ### API Reference : Presigned Operations + * [`PresignedGetObject`](https://min.io/docs/minio/linux/developers/go/API.html#PresignedGetObject) * [`PresignedPutObject`](https://min.io/docs/minio/linux/developers/go/API.html#PresignedPutObject) * [`PresignedHeadObject`](https://min.io/docs/minio/linux/developers/go/API.html#PresignedHeadObject) * [`PresignedPostPolicy`](https://min.io/docs/minio/linux/developers/go/API.html#PresignedPostPolicy) ### API Reference : Client custom settings + * [`SetAppInfo`](https://min.io/docs/minio/linux/developers/go/API.html#SetAppInfo) * [`TraceOn`](https://min.io/docs/minio/linux/developers/go/API.html#TraceOn) * [`TraceOff`](https://min.io/docs/minio/linux/developers/go/API.html#TraceOff) @@ -177,6 +229,7 @@ The full API Reference is available here. ## Full Examples ### Full Examples : Bucket Operations + * [makebucket.go](https://github.com/minio/minio-go/blob/master/examples/s3/makebucket.go) * [listbuckets.go](https://github.com/minio/minio-go/blob/master/examples/s3/listbuckets.go) * [bucketexists.go](https://github.com/minio/minio-go/blob/master/examples/s3/bucketexists.go) @@ -186,25 +239,30 @@ The full API Reference is available here. * [listincompleteuploads.go](https://github.com/minio/minio-go/blob/master/examples/s3/listincompleteuploads.go) ### Full Examples : Bucket policy Operations + * [setbucketpolicy.go](https://github.com/minio/minio-go/blob/master/examples/s3/setbucketpolicy.go) * [getbucketpolicy.go](https://github.com/minio/minio-go/blob/master/examples/s3/getbucketpolicy.go) * [listbucketpolicies.go](https://github.com/minio/minio-go/blob/master/examples/s3/listbucketpolicies.go) ### Full Examples : Bucket lifecycle Operations + * [setbucketlifecycle.go](https://github.com/minio/minio-go/blob/master/examples/s3/setbucketlifecycle.go) * [getbucketlifecycle.go](https://github.com/minio/minio-go/blob/master/examples/s3/getbucketlifecycle.go) ### Full Examples : Bucket encryption Operations + * [setbucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/setbucketencryption.go) * [getbucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/getbucketencryption.go) * [deletebucketencryption.go](https://github.com/minio/minio-go/blob/master/examples/s3/deletebucketencryption.go) ### Full Examples : Bucket replication Operations + * [setbucketreplication.go](https://github.com/minio/minio-go/blob/master/examples/s3/setbucketreplication.go) * [getbucketreplication.go](https://github.com/minio/minio-go/blob/master/examples/s3/getbucketreplication.go) * [removebucketreplication.go](https://github.com/minio/minio-go/blob/master/examples/s3/removebucketreplication.go) ### Full Examples : Bucket notification Operations + * [setbucketnotification.go](https://github.com/minio/minio-go/blob/master/examples/s3/setbucketnotification.go) * [getbucketnotification.go](https://github.com/minio/minio-go/blob/master/examples/s3/getbucketnotification.go) * [removeallbucketnotification.go](https://github.com/minio/minio-go/blob/master/examples/s3/removeallbucketnotification.go) @@ -212,10 +270,12 @@ The full API Reference is available here. * [listennotification.go](https://github.com/minio/minio-go/blob/master/examples/minio/listen-notification.go) (MinIO Extension) ### Full Examples : File Object Operations + * [fputobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/fputobject.go) * [fgetobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/fgetobject.go) ### Full Examples : Object Operations + * [putobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/putobject.go) * [getobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/getobject.go) * [statobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/statobject.go) @@ -225,22 +285,28 @@ The full API Reference is available here. * [removeobjects.go](https://github.com/minio/minio-go/blob/master/examples/s3/removeobjects.go) ### Full Examples : Encrypted Object Operations + * [put-encrypted-object.go](https://github.com/minio/minio-go/blob/master/examples/s3/put-encrypted-object.go) * [get-encrypted-object.go](https://github.com/minio/minio-go/blob/master/examples/s3/get-encrypted-object.go) * [fput-encrypted-object.go](https://github.com/minio/minio-go/blob/master/examples/s3/fputencrypted-object.go) ### Full Examples : Presigned Operations + * [presignedgetobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/presignedgetobject.go) * [presignedputobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/presignedputobject.go) * [presignedheadobject.go](https://github.com/minio/minio-go/blob/master/examples/s3/presignedheadobject.go) * [presignedpostpolicy.go](https://github.com/minio/minio-go/blob/master/examples/s3/presignedpostpolicy.go) ## Explore Further + +* [Godoc Documentation](https://pkg.go.dev/github.com/minio/minio-go/v7) * [Complete Documentation](https://min.io/docs/minio/kubernetes/upstream/index.html) * [MinIO Go Client SDK API Reference](https://min.io/docs/minio/linux/developers/go/API.html) ## Contribute + [Contributors Guide](https://github.com/minio/minio-go/blob/master/CONTRIBUTING.md) ## License + This SDK is distributed under the [Apache License, Version 2.0](https://www.apache.org/licenses/LICENSE-2.0), see [LICENSE](https://github.com/minio/minio-go/blob/master/LICENSE) and [NOTICE](https://github.com/minio/minio-go/blob/master/NOTICE) for more information. diff --git a/vendor/github.com/minio/minio-go/v7/api-get-object.go b/vendor/github.com/minio/minio-go/v7/api-get-object.go index e31e4cf92..9e6b1543c 100644 --- a/vendor/github.com/minio/minio-go/v7/api-get-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-get-object.go @@ -550,6 +550,8 @@ func (o *Object) Seek(offset int64, whence int) (n int64, err error) { } } + newOffset := o.currOffset + // Switch through whence. switch whence { default: @@ -558,12 +560,12 @@ func (o *Object) Seek(offset int64, whence int) (n int64, err error) { if o.objectInfo.Size > -1 && offset > o.objectInfo.Size { return 0, io.EOF } - o.currOffset = offset + newOffset = offset case 1: if o.objectInfo.Size > -1 && o.currOffset+offset > o.objectInfo.Size { return 0, io.EOF } - o.currOffset += offset + newOffset += offset case 2: // If we don't know the object size return an error for io.SeekEnd if o.objectInfo.Size < 0 { @@ -579,7 +581,7 @@ func (o *Object) Seek(offset int64, whence int) (n int64, err error) { if o.objectInfo.Size+offset < 0 { return 0, errInvalidArgument(fmt.Sprintf("Seeking at negative offset not allowed for %d", whence)) } - o.currOffset = o.objectInfo.Size + offset + newOffset = o.objectInfo.Size + offset } // Reset the saved error since we successfully seeked, let the Read // and ReadAt decide. @@ -587,8 +589,9 @@ func (o *Object) Seek(offset int64, whence int) (n int64, err error) { o.prevErr = nil } - // Ask lower level to fetch again from source - o.seekData = true + // Ask lower level to fetch again from source when necessary + o.seekData = (newOffset != o.currOffset) || o.seekData + o.currOffset = newOffset // Return the effective offset. return o.currOffset, nil diff --git a/vendor/github.com/minio/minio-go/v7/api-get-options.go b/vendor/github.com/minio/minio-go/v7/api-get-options.go index bb86a5994..a0216e201 100644 --- a/vendor/github.com/minio/minio-go/v7/api-get-options.go +++ b/vendor/github.com/minio/minio-go/v7/api-get-options.go @@ -87,10 +87,10 @@ func (o *GetObjectOptions) Set(key, value string) { } // SetReqParam - set request query string parameter -// supported key: see supportedQueryValues. +// supported key: see supportedQueryValues and allowedCustomQueryPrefix. // If an unsupported key is passed in, it will be ignored and nothing will be done. func (o *GetObjectOptions) SetReqParam(key, value string) { - if !isStandardQueryValue(key) { + if !isCustomQueryValue(key) && !isStandardQueryValue(key) { // do nothing return } @@ -101,10 +101,10 @@ func (o *GetObjectOptions) SetReqParam(key, value string) { } // AddReqParam - add request query string parameter -// supported key: see supportedQueryValues. +// supported key: see supportedQueryValues and allowedCustomQueryPrefix. // If an unsupported key is passed in, it will be ignored and nothing will be done. func (o *GetObjectOptions) AddReqParam(key, value string) { - if !isStandardQueryValue(key) { + if !isCustomQueryValue(key) && !isStandardQueryValue(key) { // do nothing return } diff --git a/vendor/github.com/minio/minio-go/v7/api-object-tagging.go b/vendor/github.com/minio/minio-go/v7/api-object-tagging.go index 305c36de8..6623e262a 100644 --- a/vendor/github.com/minio/minio-go/v7/api-object-tagging.go +++ b/vendor/github.com/minio/minio-go/v7/api-object-tagging.go @@ -32,6 +32,12 @@ import ( // to update tag(s) of a specific object version type PutObjectTaggingOptions struct { VersionID string + Internal AdvancedObjectTaggingOptions +} + +// AdvancedObjectTaggingOptions for internal use by MinIO server - not intended for client use. +type AdvancedObjectTaggingOptions struct { + ReplicationProxyRequest string } // PutObjectTagging replaces or creates object tag(s) and can target @@ -50,7 +56,10 @@ func (c *Client) PutObjectTagging(ctx context.Context, bucketName, objectName st if opts.VersionID != "" { urlValues.Set("versionId", opts.VersionID) } - + headers := make(http.Header, 0) + if opts.Internal.ReplicationProxyRequest != "" { + headers.Set(minIOBucketReplicationProxyRequest, opts.Internal.ReplicationProxyRequest) + } reqBytes, err := xml.Marshal(otags) if err != nil { return err @@ -63,6 +72,7 @@ func (c *Client) PutObjectTagging(ctx context.Context, bucketName, objectName st contentBody: bytes.NewReader(reqBytes), contentLength: int64(len(reqBytes)), contentMD5Base64: sumMD5Base64(reqBytes), + customHeader: headers, } // Execute PUT to set a object tagging. @@ -83,6 +93,7 @@ func (c *Client) PutObjectTagging(ctx context.Context, bucketName, objectName st // to fetch the tagging key/value pairs type GetObjectTaggingOptions struct { VersionID string + Internal AdvancedObjectTaggingOptions } // GetObjectTagging fetches object tag(s) with options to target @@ -96,12 +107,16 @@ func (c *Client) GetObjectTagging(ctx context.Context, bucketName, objectName st if opts.VersionID != "" { urlValues.Set("versionId", opts.VersionID) } - + headers := make(http.Header, 0) + if opts.Internal.ReplicationProxyRequest != "" { + headers.Set(minIOBucketReplicationProxyRequest, opts.Internal.ReplicationProxyRequest) + } // Execute GET on object to get object tag(s) resp, err := c.executeMethod(ctx, http.MethodGet, requestMetadata{ - bucketName: bucketName, - objectName: objectName, - queryValues: urlValues, + bucketName: bucketName, + objectName: objectName, + queryValues: urlValues, + customHeader: headers, }) defer closeResponse(resp) @@ -121,6 +136,7 @@ func (c *Client) GetObjectTagging(ctx context.Context, bucketName, objectName st // RemoveObjectTaggingOptions holds the version id of the object to remove type RemoveObjectTaggingOptions struct { VersionID string + Internal AdvancedObjectTaggingOptions } // RemoveObjectTagging removes object tag(s) with options to control a specific object @@ -134,12 +150,16 @@ func (c *Client) RemoveObjectTagging(ctx context.Context, bucketName, objectName if opts.VersionID != "" { urlValues.Set("versionId", opts.VersionID) } - + headers := make(http.Header, 0) + if opts.Internal.ReplicationProxyRequest != "" { + headers.Set(minIOBucketReplicationProxyRequest, opts.Internal.ReplicationProxyRequest) + } // Execute DELETE on object to remove object tag(s) resp, err := c.executeMethod(ctx, http.MethodDelete, requestMetadata{ - bucketName: bucketName, - objectName: objectName, - queryValues: urlValues, + bucketName: bucketName, + objectName: objectName, + queryValues: urlValues, + customHeader: headers, }) defer closeResponse(resp) diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object.go b/vendor/github.com/minio/minio-go/v7/api-put-object.go index 2c4de4f96..bbd8924e2 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object.go @@ -77,6 +77,7 @@ type PutObjectOptions struct { ContentDisposition string ContentLanguage string CacheControl string + Expires time.Time Mode RetentionMode RetainUntilDate time.Time ServerSideEncryption encrypt.ServerSide @@ -153,6 +154,10 @@ func (opts PutObjectOptions) Header() (header http.Header) { header.Set("Cache-Control", opts.CacheControl) } + if !opts.Expires.IsZero() { + header.Set("Expires", opts.Expires.UTC().Format(http.TimeFormat)) + } + if opts.Mode != "" { header.Set(amzLockMode, opts.Mode.String()) } diff --git a/vendor/github.com/minio/minio-go/v7/api-putobject-snowball.go b/vendor/github.com/minio/minio-go/v7/api-putobject-snowball.go index 983ed6744..eb4da4147 100644 --- a/vendor/github.com/minio/minio-go/v7/api-putobject-snowball.go +++ b/vendor/github.com/minio/minio-go/v7/api-putobject-snowball.go @@ -24,6 +24,7 @@ import ( "context" "fmt" "io" + "net/http" "os" "strings" "sync" @@ -70,6 +71,14 @@ type SnowballObject struct { // Exactly 'Size' number of bytes must be provided. Content io.Reader + // VersionID of the object; if empty, a new versionID will be generated + VersionID string + + // Headers contains more options for this object upload, the same as you + // would include in a regular PutObject operation, such as user metadata + // and content-disposition, expires, .. + Headers http.Header + // Close will be called when an object has finished processing. // Note that if PutObjectsSnowball returns because of an error, // objects not consumed from the input will NOT have been closed. @@ -181,6 +190,14 @@ objectLoop: header.ModTime = time.Now().UTC() } + header.PAXRecords = make(map[string]string) + if obj.VersionID != "" { + header.PAXRecords["minio.versionId"] = obj.VersionID + } + for k, vals := range obj.Headers { + header.PAXRecords["minio.metadata."+k] = strings.Join(vals, ",") + } + if err := t.WriteHeader(&header); err != nil { closeObj() return err diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index e8e324a9c..f8a9b34cb 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -127,7 +127,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.63" + libraryVersion = "v7.0.66" ) // User Agent should always following the below style. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go index 1c73d1008..800c4a294 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go @@ -93,7 +93,8 @@ type STSAssumeRoleOptions struct { AccessKey string SecretKey string - Policy string // Optional to assign a policy to the assumed role + SessionToken string // Optional if the first request is made with temporary credentials. + Policy string // Optional to assign a policy to the assumed role Location string // Optional commonly needed with AWS STS. DurationSeconds int // Optional defaults to 1 hour. @@ -101,6 +102,7 @@ type STSAssumeRoleOptions struct { // Optional only valid if using with AWS STS RoleARN string RoleSessionName string + ExternalID string } // NewSTSAssumeRole returns a pointer to a new @@ -161,6 +163,9 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume if opts.Policy != "" { v.Set("Policy", opts.Policy) } + if opts.ExternalID != "" { + v.Set("ExternalId", opts.ExternalID) + } u, err := url.Parse(endpoint) if err != nil { @@ -181,6 +186,9 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume } req.Header.Set("Content-Type", "application/x-www-form-urlencoded") req.Header.Set("X-Amz-Content-Sha256", hex.EncodeToString(hash.Sum(nil))) + if opts.SessionToken != "" { + req.Header.Set("X-Amz-Security-Token", opts.SessionToken) + } req = signer.SignV4STS(*req, opts.AccessKey, opts.SecretKey, opts.Location) resp, err := clnt.Do(req) diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go index 0c9536deb..c5153c4ca 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go @@ -54,19 +54,36 @@ type IAM struct { // Custom endpoint to fetch IAM role credentials. Endpoint string + + // Region configurable custom region for STS + Region string + + // Support for container authorization token https://docs.aws.amazon.com/sdkref/latest/guide/feature-container-credentials.html + Container struct { + AuthorizationToken string + CredentialsFullURI string + CredentialsRelativeURI string + } + + // EKS based k8s RBAC authorization - https://docs.aws.amazon.com/eks/latest/userguide/pod-configuration.html + EKSIdentity struct { + TokenFile string + RoleARN string + RoleSessionName string + } } // IAM Roles for Amazon EC2 // http://docs.aws.amazon.com/AWSEC2/latest/UserGuide/iam-roles-for-amazon-ec2.html const ( - defaultIAMRoleEndpoint = "http://169.254.169.254" - defaultECSRoleEndpoint = "http://169.254.170.2" - defaultSTSRoleEndpoint = "https://sts.amazonaws.com" - defaultIAMSecurityCredsPath = "/latest/meta-data/iam/security-credentials/" - tokenRequestTTLHeader = "X-aws-ec2-metadata-token-ttl-seconds" - tokenPath = "/latest/api/token" - tokenTTL = "21600" - tokenRequestHeader = "X-aws-ec2-metadata-token" + DefaultIAMRoleEndpoint = "http://169.254.169.254" + DefaultECSRoleEndpoint = "http://169.254.170.2" + DefaultSTSRoleEndpoint = "https://sts.amazonaws.com" + DefaultIAMSecurityCredsPath = "/latest/meta-data/iam/security-credentials/" + TokenRequestTTLHeader = "X-aws-ec2-metadata-token-ttl-seconds" + TokenPath = "/latest/api/token" + TokenTTL = "21600" + TokenRequestHeader = "X-aws-ec2-metadata-token" ) // NewIAM returns a pointer to a new Credentials object wrapping the IAM. @@ -84,21 +101,55 @@ func NewIAM(endpoint string) *Credentials { // the desired func (m *IAM) Retrieve() (Value, error) { token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN") + if token == "" { + token = m.Container.AuthorizationToken + } + + relativeURI := os.Getenv("AWS_CONTAINER_CREDENTIALS_RELATIVE_URI") + if relativeURI == "" { + relativeURI = m.Container.CredentialsRelativeURI + } + + fullURI := os.Getenv("AWS_CONTAINER_CREDENTIALS_FULL_URI") + if fullURI == "" { + fullURI = m.Container.CredentialsFullURI + } + + identityFile := os.Getenv("AWS_WEB_IDENTITY_TOKEN_FILE") + if identityFile == "" { + identityFile = m.EKSIdentity.TokenFile + } + + roleArn := os.Getenv("AWS_ROLE_ARN") + if roleArn == "" { + roleArn = m.EKSIdentity.RoleARN + } + + roleSessionName := os.Getenv("AWS_ROLE_SESSION_NAME") + if roleSessionName == "" { + roleSessionName = m.EKSIdentity.RoleSessionName + } + + region := os.Getenv("AWS_REGION") + if region == "" { + region = m.Region + } + var roleCreds ec2RoleCredRespBody var err error endpoint := m.Endpoint switch { - case len(os.Getenv("AWS_WEB_IDENTITY_TOKEN_FILE")) > 0: + case identityFile != "": if len(endpoint) == 0 { - if len(os.Getenv("AWS_REGION")) > 0 { - if strings.HasPrefix(os.Getenv("AWS_REGION"), "cn-") { - endpoint = "https://sts." + os.Getenv("AWS_REGION") + ".amazonaws.com.cn" + if region != "" { + if strings.HasPrefix(region, "cn-") { + endpoint = "https://sts." + region + ".amazonaws.com.cn" } else { - endpoint = "https://sts." + os.Getenv("AWS_REGION") + ".amazonaws.com" + endpoint = "https://sts." + region + ".amazonaws.com" } } else { - endpoint = defaultSTSRoleEndpoint + endpoint = DefaultSTSRoleEndpoint } } @@ -106,15 +157,15 @@ func (m *IAM) Retrieve() (Value, error) { Client: m.Client, STSEndpoint: endpoint, GetWebIDTokenExpiry: func() (*WebIdentityToken, error) { - token, err := os.ReadFile(os.Getenv("AWS_WEB_IDENTITY_TOKEN_FILE")) + token, err := os.ReadFile(identityFile) if err != nil { return nil, err } return &WebIdentityToken{Token: string(token)}, nil }, - RoleARN: os.Getenv("AWS_ROLE_ARN"), - roleSessionName: os.Getenv("AWS_ROLE_SESSION_NAME"), + RoleARN: roleArn, + roleSessionName: roleSessionName, } stsWebIdentityCreds, err := creds.Retrieve() @@ -123,17 +174,16 @@ func (m *IAM) Retrieve() (Value, error) { } return stsWebIdentityCreds, err - case len(os.Getenv("AWS_CONTAINER_CREDENTIALS_RELATIVE_URI")) > 0: + case relativeURI != "": if len(endpoint) == 0 { - endpoint = fmt.Sprintf("%s%s", defaultECSRoleEndpoint, - os.Getenv("AWS_CONTAINER_CREDENTIALS_RELATIVE_URI")) + endpoint = fmt.Sprintf("%s%s", DefaultECSRoleEndpoint, relativeURI) } roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) - case len(os.Getenv("AWS_CONTAINER_CREDENTIALS_FULL_URI")) > 0: + case fullURI != "": if len(endpoint) == 0 { - endpoint = os.Getenv("AWS_CONTAINER_CREDENTIALS_FULL_URI") + endpoint = fullURI var ok bool if ok, err = isLoopback(endpoint); !ok { if err == nil { @@ -189,7 +239,7 @@ func getIAMRoleURL(endpoint string) (*url.URL, error) { if err != nil { return nil, err } - u.Path = defaultIAMSecurityCredsPath + u.Path = DefaultIAMSecurityCredsPath return u, nil } @@ -203,7 +253,7 @@ func listRoleNames(client *http.Client, u *url.URL, token string) ([]string, err return nil, err } if token != "" { - req.Header.Add(tokenRequestHeader, token) + req.Header.Add(TokenRequestHeader, token) } resp, err := client.Do(req) if err != nil { @@ -258,11 +308,11 @@ func fetchIMDSToken(client *http.Client, endpoint string) (string, error) { ctx, cancel := context.WithTimeout(context.Background(), time.Second) defer cancel() - req, err := http.NewRequestWithContext(ctx, http.MethodPut, endpoint+tokenPath, nil) + req, err := http.NewRequestWithContext(ctx, http.MethodPut, endpoint+TokenPath, nil) if err != nil { return "", err } - req.Header.Add(tokenRequestTTLHeader, tokenTTL) + req.Header.Add(TokenRequestTTLHeader, TokenTTL) resp, err := client.Do(req) if err != nil { return "", err @@ -285,7 +335,7 @@ func fetchIMDSToken(client *http.Client, endpoint string) (string, error) { // reading the response an error will be returned. func getCredentials(client *http.Client, endpoint string) (ec2RoleCredRespBody, error) { if endpoint == "" { - endpoint = defaultIAMRoleEndpoint + endpoint = DefaultIAMRoleEndpoint } // https://docs.aws.amazon.com/AWSEC2/latest/UserGuide/configuring-instance-metadata-service.html @@ -332,7 +382,7 @@ func getCredentials(client *http.Client, endpoint string) (ec2RoleCredRespBody, return ec2RoleCredRespBody{}, err } if token != "" { - req.Header.Add(tokenRequestHeader, token) + req.Header.Add(TokenRequestHeader, token) } resp, err := client.Do(req) diff --git a/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go b/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go index 830061b8e..c52f78c3f 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go @@ -211,35 +211,43 @@ func (t Transition) MarshalXML(en *xml.Encoder, startElement xml.StartElement) e // And And Rule for LifecycleTag, to be used in LifecycleRuleFilter type And struct { - XMLName xml.Name `xml:"And" json:"-"` - Prefix string `xml:"Prefix" json:"Prefix,omitempty"` - Tags []Tag `xml:"Tag" json:"Tags,omitempty"` + XMLName xml.Name `xml:"And" json:"-"` + Prefix string `xml:"Prefix" json:"Prefix,omitempty"` + Tags []Tag `xml:"Tag" json:"Tags,omitempty"` + ObjectSizeLessThan int64 `xml:"ObjectSizeLessThan,omitempty" json:"ObjectSizeLessThan,omitempty"` + ObjectSizeGreaterThan int64 `xml:"ObjectSizeGreaterThan,omitempty" json:"ObjectSizeGreaterThan,omitempty"` } // IsEmpty returns true if Tags field is null func (a And) IsEmpty() bool { - return len(a.Tags) == 0 && a.Prefix == "" + return len(a.Tags) == 0 && a.Prefix == "" && + a.ObjectSizeLessThan == 0 && a.ObjectSizeGreaterThan == 0 } // Filter will be used in selecting rule(s) for lifecycle configuration type Filter struct { - XMLName xml.Name `xml:"Filter" json:"-"` - And And `xml:"And,omitempty" json:"And,omitempty"` - Prefix string `xml:"Prefix,omitempty" json:"Prefix,omitempty"` - Tag Tag `xml:"Tag,omitempty" json:"Tag,omitempty"` + XMLName xml.Name `xml:"Filter" json:"-"` + And And `xml:"And,omitempty" json:"And,omitempty"` + Prefix string `xml:"Prefix,omitempty" json:"Prefix,omitempty"` + Tag Tag `xml:"Tag,omitempty" json:"Tag,omitempty"` + ObjectSizeLessThan int64 `xml:"ObjectSizeLessThan,omitempty" json:"ObjectSizeLessThan,omitempty"` + ObjectSizeGreaterThan int64 `xml:"ObjectSizeGreaterThan,omitempty" json:"ObjectSizeGreaterThan,omitempty"` } // IsNull returns true if all Filter fields are empty. func (f Filter) IsNull() bool { - return f.Tag.IsEmpty() && f.And.IsEmpty() && f.Prefix == "" + return f.Tag.IsEmpty() && f.And.IsEmpty() && f.Prefix == "" && + f.ObjectSizeLessThan == 0 && f.ObjectSizeGreaterThan == 0 } // MarshalJSON customizes json encoding by removing empty values. func (f Filter) MarshalJSON() ([]byte, error) { type filter struct { - And *And `json:"And,omitempty"` - Prefix string `json:"Prefix,omitempty"` - Tag *Tag `json:"Tag,omitempty"` + And *And `json:"And,omitempty"` + Prefix string `json:"Prefix,omitempty"` + Tag *Tag `json:"Tag,omitempty"` + ObjectSizeLessThan int64 `json:"ObjectSizeLessThan,omitempty"` + ObjectSizeGreaterThan int64 `json:"ObjectSizeGreaterThan,omitempty"` } newf := filter{ @@ -251,6 +259,8 @@ func (f Filter) MarshalJSON() ([]byte, error) { if !f.And.IsEmpty() { newf.And = &f.And } + newf.ObjectSizeLessThan = f.ObjectSizeLessThan + newf.ObjectSizeGreaterThan = f.ObjectSizeGreaterThan return json.Marshal(newf) } @@ -271,7 +281,19 @@ func (f Filter) MarshalXML(e *xml.Encoder, start xml.StartElement) error { return err } default: - // Always print Prefix field when both And & Tag are empty + if f.ObjectSizeLessThan > 0 { + if err := e.EncodeElement(f.ObjectSizeLessThan, xml.StartElement{Name: xml.Name{Local: "ObjectSizeLessThan"}}); err != nil { + return err + } + break + } + if f.ObjectSizeGreaterThan > 0 { + if err := e.EncodeElement(f.ObjectSizeGreaterThan, xml.StartElement{Name: xml.Name{Local: "ObjectSizeGreaterThan"}}); err != nil { + return err + } + break + } + // Print empty Prefix field only when everything else is empty if err := e.EncodeElement(f.Prefix, xml.StartElement{Name: xml.Name{Local: "Prefix"}}); err != nil { return err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go b/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go index 01cc26fc2..a44799d24 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go @@ -37,9 +37,15 @@ const ( ObjectCreatedPut EventType = "s3:ObjectCreated:Put" ObjectCreatedPost EventType = "s3:ObjectCreated:Post" ObjectCreatedCopy EventType = "s3:ObjectCreated:Copy" + ObjectCreatedDeleteTagging EventType = "s3:ObjectCreated:DeleteTagging" ObjectCreatedCompleteMultipartUpload EventType = "s3:ObjectCreated:CompleteMultipartUpload" + ObjectCreatedPutLegalHold EventType = "s3:ObjectCreated:PutLegalHold" + ObjectCreatedPutRetention EventType = "s3:ObjectCreated:PutRetention" + ObjectCreatedPutTagging EventType = "s3:ObjectCreated:PutTagging" ObjectAccessedGet EventType = "s3:ObjectAccessed:Get" ObjectAccessedHead EventType = "s3:ObjectAccessed:Head" + ObjectAccessedGetRetention EventType = "s3:ObjectAccessed:GetRetention" + ObjectAccessedGetLegalHold EventType = "s3:ObjectAccessed:GetLegalHold" ObjectAccessedAll EventType = "s3:ObjectAccessed:*" ObjectRemovedAll EventType = "s3:ObjectRemoved:*" ObjectRemovedDelete EventType = "s3:ObjectRemoved:Delete" @@ -56,6 +62,9 @@ const ( ObjectReplicationOperationMissedThreshold EventType = "s3:Replication:OperationMissedThreshold" ObjectReplicationOperationNotTracked EventType = "s3:Replication:OperationNotTracked" ObjectReplicationOperationReplicatedAfterThreshold EventType = "s3:Replication:OperationReplicatedAfterThreshold" + ObjectScannerManyVersions EventType = "s3:Scanner:ManyVersions" + ObjectScannerBigPrefix EventType = "s3:Scanner:BigPrefix" + ObjectScannerAll EventType = "s3:Scanner:*" BucketCreatedAll EventType = "s3:BucketCreated:*" BucketRemovedAll EventType = "s3:BucketRemoved:*" ) diff --git a/vendor/github.com/minio/minio-go/v7/s3-endpoints.go b/vendor/github.com/minio/minio-go/v7/s3-endpoints.go index 0a26edd5a..b1de7b62a 100644 --- a/vendor/github.com/minio/minio-go/v7/s3-endpoints.go +++ b/vendor/github.com/minio/minio-go/v7/s3-endpoints.go @@ -50,6 +50,7 @@ var awsS3EndpointMap = map[string]string{ "cn-northwest-1": "s3.dualstack.cn-northwest-1.amazonaws.com.cn", "ap-southeast-3": "s3.dualstack.ap-southeast-3.amazonaws.com", "ap-southeast-4": "s3.dualstack.ap-southeast-4.amazonaws.com", + "il-central-1": "s3.dualstack.il-central-1.amazonaws.com", } // getS3Endpoint get Amazon S3 endpoint based on the bucket location. diff --git a/vendor/github.com/minio/minio-go/v7/utils.go b/vendor/github.com/minio/minio-go/v7/utils.go index 6a93561ea..e39eba028 100644 --- a/vendor/github.com/minio/minio-go/v7/utils.go +++ b/vendor/github.com/minio/minio-go/v7/utils.go @@ -528,6 +528,14 @@ func isStandardQueryValue(qsKey string) bool { return supportedQueryValues[qsKey] } +// Per documentation at https://docs.aws.amazon.com/AmazonS3/latest/userguide/LogFormat.html#LogFormatCustom, the +// set of query params starting with "x-" are ignored by S3. +const allowedCustomQueryPrefix = "x-" + +func isCustomQueryValue(qsKey string) bool { + return strings.HasPrefix(qsKey, allowedCustomQueryPrefix) +} + var ( md5Pool = sync.Pool{New: func() interface{} { return md5.New() }} sha256Pool = sync.Pool{New: func() interface{} { return sha256.New() }} diff --git a/vendor/modules.txt b/vendor/modules.txt index 46ab8d3bb..de521a740 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -95,7 +95,7 @@ github.com/google/go-jsonnet/internal/program ## explicit; go 1.12 github.com/google/gofuzz github.com/google/gofuzz/bytesource -# github.com/google/uuid v1.3.1 +# github.com/google/uuid v1.5.0 ## explicit github.com/google/uuid # github.com/hashicorp/hcl v1.0.0 @@ -131,8 +131,8 @@ github.com/jpillora/backoff # github.com/json-iterator/go v1.1.12 ## explicit; go 1.12 github.com/json-iterator/go -# github.com/klauspost/compress v1.17.0 -## explicit; go 1.18 +# github.com/klauspost/compress v1.17.4 +## explicit; go 1.19 github.com/klauspost/compress github.com/klauspost/compress/flate github.com/klauspost/compress/fse @@ -144,7 +144,7 @@ github.com/klauspost/compress/s2 github.com/klauspost/compress/snappy github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.5 +# github.com/klauspost/cpuid/v2 v2.2.6 ## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/libp2p/go-reuseport v0.3.0 @@ -170,7 +170,7 @@ github.com/mdlayher/ethernet # github.com/minio/md5-simd v1.1.2 ## explicit; go 1.14 github.com/minio/md5-simd -# github.com/minio/minio-go/v7 v7.0.63 +# github.com/minio/minio-go/v7 v7.0.66 ## explicit; go 1.17 github.com/minio/minio-go/v7 github.com/minio/minio-go/v7/pkg/credentials