Skip to content

Latest commit

 

History

History
82 lines (61 loc) · 4.29 KB

README.md

File metadata and controls

82 lines (61 loc) · 4.29 KB

gLM2: A mixed-modality Genomic Language Model

bioRxiv URLHuggingface URL

gLM2 is a mixed-modality genomic language model, trained on the OMG Dataset.

The model encodes a genomic scaffold with both both amino-acid and DNA tokens. gLM2 is trained at two scales: 150M and 650M parameters.

Model Description

gLM2 is a transformer encoder trained with the masked language modeling objective.
It encodes a genomic contig as a sequence of protein coding sequences (CDS) and DNA inter-genic sequences (IGS).
CDS elements are tokenized using per-amino acid tokens, and IGS elements are tokenized using per-nucleotide tokens.

  • To encode the genomic strand, we prepended each genomic element with a special token, either <+> or <-> to indicate the positive and negative strands.
  • To avoid collision between amino acid and nucleotide tokens, the tokenizer expects all amino acids to be uppercase, and all nucleotides to be lowercase.

UPDATE(09/2024): We updated the model with longer context length (4096 tokens vs. 2048 tokens) and per-nucleotide IGS tokenization.

Usage

import torch
from transformers import AutoModel, AutoTokenizer
model = AutoModel.from_pretrained('tattabio/gLM2_650M', torch_dtype=torch.bfloat16, trust_remote_code=True).cuda()
tokenizer = AutoTokenizer.from_pretrained('tattabio/gLM2_650M', trust_remote_code=True)

# A contig with two proteins and an inter-genic sequence.
# NOTE: Nucleotides should always be lowercase, and prepended with `<+>`.
sequence = "<+>MALTKVEKRNRIKRRVRGKISGTQASPRLSVYKSNK<+>aatttaaggaa<->MLGIDNIERVKPGGLELVDRLVAVNRVTKVTKGGRAFGFSAIVVVGNED"

# Tokenize the sequence.
encodings = tokenizer([sequence], return_tensors='pt')
# Extract embeddings.
with torch.no_grad():
    embeddings = model(encodings.input_ids.cuda(), output_hidden_states=True).last_hidden_state

Scripts

We provide a script to visualize protein-protein interaction by computing the gLM2 categorical jacobian (Zhang et al. 2024).

For example, gLM2 correctly predicts interactions between 2ONK_A (ModA) and 2ONK_C (ModC). In comparison, ESM2 and Evo do not predict any interactions.

PPI Figure

Training Data

gLM2 is trained on the OMG dataset. To improve the dataset balance and remove near-duplicate examples, the data is tokenized and pruned by applying Semantic Deduplication (SemDedup).
We use an embedding distance threshold of 2e-3, resulting in 49% of the dataset being pruned.

Citing

gLM2 was introduced in "The OMG dataset: An Open MetaGenomic corpus for mixed-modality genomic language modeling", feel free to cite:

@article{Cornman2024,
  title = {The OMG dataset: An Open MetaGenomic corpus for mixed-modality genomic language modeling},
  url = {https://www.biorxiv.org/content/early/2024/08/17/2024.08.14.607850},
  DOI = {10.1101/2024.08.14.607850},
  publisher = {Cold Spring Harbor Laboratory},
  author = {Cornman, Andre and West-Roberts, Jacob and Camargo, Antonio Pedro and Roux, Simon and Beracochea, Martin and Mirdita, Milot and Ovchinnikov, Sergey and Hwang, Yunha},
  year = {2024},
}